GIF89a; EcchiShell v1.0
//var/lib/rpm/

Mass Deface Џ@?RR@` MA0 ZBXECf D` !EiiF8PGHIxJ8< KPD LhM(NXXkOp[NPXXt QU RqS$H TU4 ` V 0 W8XH`Y(p Z[ ( \(7] ^! |_H `faXbpgcd0)H)eW `f18g%  hHxF iHf(j` Lk\pq l@m(  n!@qo v pq0 rstttxOuOvP wȈx y@c zz8{U`A|9 } ~eXz(  H@\0p&(&K0K(   nhp @M`( 8   iy 0 0K(xxHXH4`&&5)) & &HHPHa@@@ Packages@@ XU@<$?<<<ealpath.1.gzrm.1.gzrmdir.1.gzruncon.1.gzseq.1.gzsha1sum.1.gzsha224sum.1.gzsha256sum.1.gzsha384sum.1.gzsha512sum.1.gzshred.1.gzshuf.1.gzsleep.1.gzsort.1.gzsplit.1.gzstat.1.gzstdbuf.1.gzstty.1.gzsum.1.gzsync.1.gztac.1.gztail.1.gztee.1.gztest.1.gztimeout.1.gztouch.1.gztr.1.gztrue.1.gztruncate.1.gztsort.1.gztty.1.gzuname.1.gzunexpand.1.gzuniq.1.gzunlink.1.gzusers.1.gzvdir.1.gzwc.1.gzwho.1.gzwhoami.1.gzyes.1.gz/etc//etc/profile.d//usr/bin//usr/libexec//usr/libexec/coreutils//usr/sbin//usr/share/doc//usr/share/doc/coreutils-8.22//usr/share/doc/coreutils-8.22/fileutils//usr/share/doc/coreutils-8.22/sh-utils//usr/share/doc/coreutils-8.22/textutils//usr/share/info//usr/share/locale/af/LC_MESSAGES//usr/share/locale/af//usr/share/locale/af/LC_TIME//usr/share/locale/be/LC_MESSAGES//usr/share/locale/be//usr/share/locale/be/LC_TIME//usr/share/locale/bg/LC_MESSAGES//usr/share/locale/bg//usr/share/locale/bg/LC_TIME//usr/share/locale/ca/LC_MESSAGES//usr/share/locale/ca//usr/share/locale/ca/LC_TIME//usr/share/locale/cs/LC_MESSAGES//usr/share/locale/cs//usr/share/locale/cs/LC_TIME//usr/share/locale/da/LC_MESSAGES//usr/share/locale/da//usr/share/locale/da/LC_TIME//usr/share/locale/de/LC_MESSAGES//usr/share/locale/de//usr/share/locale/de/LC_TIME//usr/share/locale/el/LC_MESSAGES//usr/share/locale/el//usr/share/locale/el/LC_TIME//usr/share/locale/eo/LC_MESSAGES//usr/share/locale/eo//usr/share/locale/eo/LC_TIME//usr/share/locale/es/LC_MESSAGES//usr/share/locale/es//usr/share/locale/es/LC_TIME//usr/share/locale/et/LC_MESSAGES//usr/share/locale/et//usr/share/locale/et/LC_TIME//usr/share/locale/eu/LC_MESSAGES//usr/share/locale/eu//usr/share/locale/eu/LC_TIME//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fi//usr/share/locale/fi/LC_TIME//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/fr//usr/share/locale/fr/LC_TIME//usr/share/locale/ga/LC_MESSAGES//usr/share/locale/ga//usr/share/locale/ga/LC_TIME//usr/share/locale/gl/LC_MESSAGES//usr/share/locale/gl//usr/share/locale/gl/LC_TIME//usr/share/locale/hr/LC_MESSAGES//usr/share/locale/hr//usr/share/locale/hr/LC_TIME//usr/share/locale/hu/LC_MESSAGES//usr/share/locale/hu//usr/share/locale/hu/LC_TIME//usr/share/locale/ia/LC_MESSAGES//usr/share/locale/ia//usr/share/locale/ia/LC_TIME//usr/share/locale/id/LC_MESSAGES//usr/share/locale/id//usr/share/locale/id/LC_TIME//usr/share/locale/it/LC_MESSAGES//usr/share/locale/it//usr/share/locale/it/LC_TIME//usr/share/locale/ja/LC_MESSAGES//usr/share/locale/ja//usr/share/locale/ja/LC_TIME//usr/share/locale/kk/LC_MESSAGES//usr/share/locale/kk//usr/share/locale/kk/LC_TIME//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/ko//usr/share/locale/ko/LC_TIME//usr/share/locale/lg/LC_MESSAGES//usr/share/locale/lg//usr/share/locale/lg/LC_TIME//usr/share/locale/lt/LC_MESSAGES//usr/share/locale/lt//usr/share/locale/lt/LC_TIME//usr/share/locale/ms/LC_MESSAGES//usr/share/locale/ms//usr/share/locale/ms/LC_TIME//usr/share/locale/nb/LC_MESSAGES//usr/share/locale/nb//usr/share/locale/nb/LC_TIME//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/nl//usr/share/locale/nl/LC_TIME//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pl//usr/share/locale/pl/LC_TIME//usr/share/locale/pt/LC_MESSAGES//usr/share/locale/pt//usr/share/locale/pt/LC_TIME//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/pt_BR//usr/share/locale/pt_BR/LC_TIME//usr/share/locale/ro/LC_MESSAGES//usr/share/locale/ro//usr/share/locale/ro/LC_TIME//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/ru//usr/share/locale/ru/LC_TIME//usr/share/locale/sk/LC_MESSAGES//usr/share/locale/sk//usr/share/locale/sk/LC_TIME//usr/share/locale/sl/LC_MESSAGES//usr/share/locale/sl//usr/share/locale/sl/LC_TIME//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/sv//usr/share/locale/sv/LC_TIME//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/tr//usr/share/locale/tr/LC_TIME//usr/share/locale/uk/LC_MESSAGES//usr/share/locale/uk//usr/share/locale/ukx8XV~I$n~I}IIcore: fix optional waiting for networking at startup behavior (rh #710502) - ifcfg-rh: fix possible crashes in error cases - ifcfg-rh: fix various IPv4 and IPv6 handling issues - applet: add notifications of GSM mobile broadband registration status - editor: move secrets when making connections available to all users or private - applet: don't show irrelevant options when asking for passwords- keyfile: better handling of missing certificates/private keys - core: fix issues handling "always-ask" wired and WiFi 802.1x connections (rh #703785) - core: fix automatic handling of hidden WiFi networks (rh #707406) - editor: fix possible crash after reading network connections (rh #706906) - editor: make Enter/Return key close WiFi password dialogs (rh #708666)- Bump for CVE-2011-1943 (no changes, only a rebuild)- editor: fix resizing of UI elements (rh #707269) - core: retry wired connections when cable is replugged - core: fix a few warnings and remove some left-over debugging code- compat: fix activation/deactivation of VPN connections (rh #699786) - core: fix autodetection of previously-used hidden wifi networks - core: silence error if ConsoleKit database does not yet exist (rh #695617) - core: fix Ad-Hoc frequency handling (rh #699203) - core: fixes for migrated OpenConnect VPN plugin connections - core: various fixes for VPN connection secrets handling - core: send only short hostname to DHCP servers (rh #694758) - core: better handling of PKCS#8 private keys - core: fix dispatcher script interface name handling - editor: fix potential crash when connection is invalid (rh #704848) - editor: allow _ as a valid character for GSM APNs- core: fix possible crash when connections are deleted - core: fix exported symbols in libnm-util and libnm-glib - core/applet: updated translations- core: ensure DER format certificates are correctly recognized (rh #699591) - core: fix WINS server handling in client helper libraries - core: enhance dispatcher script environment to include IPv6 and VPN details - applet: migrate openswan connections to 0.9 - editor: improve usability of editing IP addresses (rh #698199)- core: enable optimized background roaming for WPA Enterprise configs - core: better handling of WiFi and WiMAX rfkill (rh #599002) - applet: fix crash detecting Bluetooth DUN devices a second time - ifcfg-rh: fix managed/unmanaged changes when removing connections (rh #698202)- core: systemd and startup enhancements for NFS mounts - core: more efficient startup process - core: fix handling of multiple logins when one is inactive - core: fix handling of S390/Hercules CTC network interfaces (rh #641986) - core: support Easytether interfaces for Android phones - core: fix handling of WWAN enable/disable states - ifcfg-rh: harmonize handling if IPADDR/PREFIX/NETMASK with initscripts (rh #658907) - applet: fix connection to WPA Enterprise networks (rh #694765)- core: fix handling of infinite IPv6 RDNSS timeouts (rh #689291)- Update to 0.8.998 (0.9.0-rc1) - core: fix near-infinite requests for passwords (rh #692783) - core: fix handling of wired 802.1x connections - core: ignore Nokia PC-Suite ethernet devices we can't use yet - applet: migrate 0.8 OpenVPN passwords to 0.9 formats- core: resurrect default VPN username - core: don't stomp on crypto library users by de-initing the crypto library- core: fix creation of default wired connections - core: fix requesting new secrets when old ones fail (ex changing WEP keys) - editor: ensure all pages are sensitive after retrieving secrets - editor: fix crash when scrolling through connection lists (rh #693446) - applet: fix crash after using the wifi or wired secrets dialogs (rh #693446)- Fix trigger to enable the systemd service for upgrades (rh #678553)- core: fix connection deactivation on the compat interface - core: give default wired connections a more friendly name - core: fix base type of newly created wired connections - applet: many updated translations- core: fix possible libnm-glib crash when activating connections - applet: fix various nax x8I( T pI P 0NameName@@X8Whu$xhuguiue test suite with Python 3. (boost-1.53.0-python-test-PyImport_AppendInittab.patch) - Patch gcc.jam to not add bogus rpaths.- do not use arch-specific BuildRequires (#1268268) - support TLS libraries without SSLv3 (#1298227)- Rebuilt for openmpi update (#1258794)- Change Requires: to use %{?_isa}, so that dependencies are arch-aware.- Fix ambiguity in Boost.LexicalCast.- Re-enable mpich and openmpi on aarch64, they are available now.- Fix atomic_cas32 (thanks Jaroslav Škarvada for figuring out where the problem is) (boost-1.54.0-interprocess-atomic_cas32-ppc.patch)- Disable mpich and openmpi support for ppc64le until port available.- Turn off build flags pre-set by Boost distribution. (boost-1.53.0-buildflags.patch) - Pass RPM_OPT_FLAGS through user-config.jam.- Fix misunderstanding of Boost.MPI about widths of some Boost.Serialization types. (boost-1.53.0-mpi-version_type.patch)- Disable mpich and openmpi support for aarch64 until port available.- Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- MPICH2 became MPICH -- rename subpackages, dependencies and conditionals. - Resolves: #1014480- Fix compilation of Boost.Pool test cases (boost-1.54.0-pool-test_linking.patch) - Fix -Wshadow warnings in Boost.Pool (boost-1.54.0-pool-max_chunks_shadow.patch) -Wshadow warnings in Boost.Thread (boost-1.54.0-thread-cond_variable_shadow.patch)- Add explicit dependencies between some of the boost sub-packages- Install supporting files (images etc.) for documentation (courtesy Marcel Metz, bug 985593) - Add many patches for silencing unused local typedef warnings (boost-1.53.0-static_assert-unused_typedef.patch, boost-1.54.0-bind-static_assert.patch, boost-1.54.0-concept-unused_typedef.patch, boost-1.54.0-static_warning-unused_typedef.patch, boost-1.54.0-math-unused_typedef.patch, boost-1.54.0-math-unused_typedef-2.patch, boost-1.53.0-fpclassify-unused_typedef.patch, boost-1.54.0-math-unused_typedef-3.patch, boost-1.54.0-tuple-unused_typedef.patch, boost-1.54.0-random-unused_typedef.patch, boost-1.54.0-date_time-unused_typedef.patch, boost-1.54.0-date_time-unused_typedef-2.patch, boost-1.54.0-spirit-unused_typedef.patch, boost-1.54.0-spirit-unused_typedef-2.patch, boost-1.54.0-numeric-unused_typedef.patch, boost-1.54.0-multiprecision-unused_typedef.patch, boost-1.53.0-lexical_cast-unused_typedef.patch, boost-1.53.0-regex-unused_typedef.patch, boost-1.53.0-thread-unused_typedef.patch, boost-1.54.0-unordered-unused_typedef.patch, boost-1.54.0-algorithm-unused_typedef.patch, boost-1.53.0-graph-unused_typedef.patch, boost-1.54.0-locale-unused_typedef.patch, boost-1.54.0-property_tree-unused_typedef.patch, boost-1.54.0-xpressive-unused_typedef.patch, boost-1.54.0-mpi-unused_typedef.patch, boost-1.54.0-python-unused_typedef.patch) - Add a patch to turn off execstack in Boost.Context (boost-1.54.0-context-execstack.patch) - Fix boost::mpl::print on GCC (boost-1.54.0-mpl-print.patch)- Add symlinks for /usr/lib/libboost_{thread,locale}.so -> *-mt.so- libboost_context.so must be guarded by conditional in the expanded filelist at boost-devel.- Split off Python 3 DSO symlink to a separate subpackage boost-python3-devel. This makes it possible to install boost-devel separately, without Python 3 support. - Build with -fno-strict-aliasing- Make Boost.Context support conditional- Fix Boost.Context on ppc64 - Future-proof the linker script boost_thread-mt.so- Fixed the libboost_thread-mt.so script (which wrongly referred to Boost-1.50)- Upstream 1.53.0 beta1 - Drop boost-1.50.0-signals-erase.patch - Port boost-1.50.0-attribute.patch - Drop boost-1.50.0-polygon.patch - New sub-packages boost-atomic and boost-context- Rebuild for icu soname bump- Rebuild for the new MPICH2 (and libmpich2 soname bump)- Update %description to reflect current state of C++ standardization. Courtesy of Jonathan Wakely. (#837813)- Override boost_thread-mt.so with a linker script that brings in Boost.System DSO as well.- boosx XW  Ec$UEcDcFcp (#698084)- rebuild for net-snmp SONAME bump- enable mhash extension (emulated by hash extension)- rebuild for new MySQL client library- update to 5.3.6 http://www.php.net/ChangeLog-5.php#5.3.6 - fix php-pdo arch specific requires- disable zip extension per "No Bundled Libraries" policy (#551513)- rebuild for icu 4.6- fix systemd-units requires- add tmpfiles.d configuration for php-fpm - add Arch specific requires/provides- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 5.3.5 http://www.php.net/ChangeLog-5.php#5.3.5 - clean duplicate configure options- rebuild against MySQL 5.5.8 - remove all RPM_SOURCE_DIR- security patch from upstream for #660517- update to 5.3.4 http://www.php.net/ChangeLog-5.php#5.3.4 - move phpize to php-cli (see #657812)- ghost /var/run/php-fpm (see #656660) - add filter_setup to not provides extensions as .so- use mysql_config in libdir directly to avoid biarch build failures- rebuild for new net-snmp- add php-fpm sub-package- PHP 5.3.3 released- garbage collector upstream patches (#580236)- rebuild for icu 4.4- PHP 5.3.2 Released! - remove mime_magic option (now provided by fileinfo, by emu) - add patch for http://bugs.php.net/50578 - remove patch for libedit (upstream) - add runselftest option to allow build without test suite- update to v7 of systzdata patch- fix build with autoconf 2.6x- update to 5.3.1 - remove openssl patch (merged upstream) - add provides for php-pecl-json - add prod/devel php.ini in doc- use libedit instead of readline to resolve licensing issues- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rediff systzdata patch- update to v6 of systzdata patch; various fixes- update to v5 of systzdata patch; parses zone.tab and extracts timezone->{country-code,long/lat,comment} mapping table- update to 5.3.0 - remove ncurses, dbase, mhash extensions - add enchant, sqlite3, intl, phar, fileinfo extensions - raise sqlite version to 3.6.0 (for sqlite3, build with --enable-load-extension) - sync with upstream "production" php.ini- update to 5.2.10 - add interbase sub-package- update to 5.2.9- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add recode support, -recode subpackage (#106755) - add -zts subpackage with ZTS-enabled build of httpd SAPI - adjust php.conf to use -zts SAPI build for worker MPM- fix patch fuzz, renumber patches- drop obsolete configure args - drop -odbc patch (#483690)- split out sysvshm, sysvsem, sysvmsg, posix into php-process- move wddx to php-xml, build curl shared in -common - remove BR for expat-devel, bogus configure option- rebuild for new MySQL- libtool 2 workaround for phpize (#476004) - add missing php_embed.h (#457777)- update to 5.2.8- libtool 2 workaround- update to 5.2.7 - enable pdo_dblib driver in php-mssql- tweak Summary, thanks to Richard Hughes- move gd_README to php-gd - update to r4 of systzdata patch; introduces a default timezone name of "System/Localtime", which uses /etc/localtime (#469532)- enable XPM support in php-gd - Fix BR for php-gd- enable T1lib support in php-gd- update to 5.2.6 - sync default php.ini with upstream - drop extension_dir from default php.ini, rely on hard-coded default, to make php-common multilib-safe (#455091) - update to r3 of systzdata patch- split pspell extension out into php-spell (#443857)- Autorebuild for GCC 4.3- ext/date: use system timezone database- rebuild for libc-client bump- Rebuild for openssl bump- update to 5.2.5- correct pcre BR version (#333021) - restore metaphone fix (#205714) - add READMEs to php-cli- update to 5.2.4- rebuild for fixed APR- add ldconfig post/postun for -embedded (Hans de Goede)- add php-embedded sub-package- fix build with new glibc - fix License- define php_extdir in macros.php- obsolete php-dbase- add mcrypt, mhash, tidy, mssql subpackages (Dmitry Butskoy) - enable dbase extension and package in -common- update to 5.2.3 (thanks to Jeff Sheltren)- fix php-pdo *_arg_force_ref glxXqW5O]$_O]N] 3- patchlevel 822- Only use --vendor for desktop-file-install on F18 or less- patchlevel 797- patchlevel 785- patchlevel 715- patchlevel 712- fix vim.csh syntax- patchlevel 712- patchlevel 691- patchlevel 682 - use --enable-rubyinterp=dynamic and --enable-pythoninterp=dynamic- patchlevel 646- fix some man page typos (#668894, #675480) - own usr/share/vim/vimfiles/doc/tags (#845564) - add path to csope database (#844843)- patchlevel 638 2:7.4.629-8.el7_97.4.629-8.el7_92:7.4.629-8.el7_92:7.4.629-8.el7_9vircexrvirviewviviewex.1.gzrvi.1.gzrview.1.gzvi.1.gzview.1.gzvim.1.gzvirc.5.gz/etc//usr/bin//usr/share/man/man1//usr/share/man/man5/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuASCII text, with escape sequencesELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=9e160471d61f662dedf0d6a550962b864dc92f76, strippedtroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression) RRRRR RR RR R RRR?p爉_$ƨg1d8\B_]0:|! ƳoXp 'a Giu3 o砿h<:9{ZKT31^J7M-<1Zh`f겘+?rJܞB8&ti2bx`{twaٔ-l5V$*b\Mbsfݽ)d;z.4@]PHK (|h0Rs<҃q_6YxzlU؎vHצhn }@lUS&]Q8zW]صBgqcmiJtXlN-?ɝp^^61\~u=\~n-㫵;A:Whި 0*:`sf )gM[ɧ:۠OB[:ģȾl߃,5E f漭r@n'4ZlgrjZM he23:V8Ú(T+Mن_$ƨD$`mRnL|7`|2[*H#4>Pg"۪lΤ 31v"m,2t.XV ]VZ1 a*M N@]#J^d}e`(BL(a{ɾbعw AOU KC8QSNϫkL c}KmiIP: bp8T2yHŮr^bsm,amgWEXw0/XU{&]ɪ2; @PޖG{R=dOEH6"XeՇ7aj4;p:|k?Aj(uPk]cprƈ`W-Ƚd|R=aN}2Iԃy# W%>{|yP.K/4N9b|8472bb55cc1ae2f015825d6ba1296715773ed51dbNbkvm] x86: Emulate should check #UD before #GP (Bandan Das) [1209995] - [kvm] x86: Do not push eflags.vm on pushf (Bandan Das) [1209995] - [kvm] x86: Remove prefix flag when GP macro is used (Bandan Das) [1209995] - [kvm] cpuid: recompute CPUID 0xD.0:EBX,ECX (Bandan Das) [1209995] - [kvm] cpuid: mask more bits in leaf 0xd and subleaves (Bandan Das) [1209995] - [kvm] cpuid: set CPUID(EAX=0xd, ECX=1).EBX correctly (Bandan Das) [1209995] - [kvm] x86: use F() macro throughout cpuid.c (Bandan Das) [1209995] - [kvm] track pid for VCPU only on KVM_RUN ioctl (Bandan Das) [1209995] - [kvm] don't check for PF_VCPU when yielding (Bandan Das) [1209995] - [kvm] optimize GFN to memslot lookup with large slots amount (Bandan Das) [1209995] - [kvm] change memslot sorting rule from size to GFN (Bandan Das) [1209995] - [kvm] search_memslots: add simple LRU memslot caching (Bandan Das) [1209995] - [kvm] update_memslots: drop not needed check for the same slot (Bandan Das) [1209995] - [kvm] update_memslots: drop not needed check for the same number of pages (Bandan Das) [1209995] - [kvm] x86: allow 256 logical x2APICs again (Bandan Das) [1209995] - [kvm] x86: check bounds of APIC maps (Bandan Das) [1209995] - [kvm] x86: fix APIC physical destination wrapping xXWHv$0vvB?(d   G8<TX_c        H    ( P   (D(8 98 : G H  I < X HY T\ t ] ^ b d e f !l #t < u d v w x y$8<T d | ghCyajl-devel2.0.44.el7Libraries, includes, etc to develop with YAJLYet Another JSON Library. YAJL is a small event-driven (SAX-style) JSON parser written in ANSI C, and a small validating JSON generator. This sub-package provides the libraries and includes necessary for developing against the YAJL librarySworker1.bsys.centos.orgkCentOSISCCentOS BuildSystem Development/Librarieshttp://lloyd.github.com/yajl/linuxx86_64 &ck A큤A큤SNzNzNzNzSSSSNz51cd616cfa9b04fd2a5e5859e05dabb3db39c9612445c7203cd4ba71e675165c6f6e15444d6e53626096d5077795523bf81a532b8dd35f79445d90c7733602f2fbd0ec719b4af6510ad436437f10d2f717408fb4243049780df99d86e14ea40e8db6f4b15077d2ca8f372d829ef5955826a4d5271da8882b52e490365d936e8efc90e3f2aeabf24f362693e50dfc4ecf9d0a0e03ed951d2d60be06e13f7281101570cb356949ecb2a0e7ebc6031c8e0ffa70abffda317b0f2c93b4c3a939cd6bab103de943b829030fad1f24e8cf39f5b3b6030fdab32bd0c06eaae6dc397736libyajl.so.2rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootyajl-2.0.4-4.el7.src.rpmpkgconfig(yajl)yajl-develyajl-devel(x86-64)@@    /usr/bin/pkg-configlibyajl.so.2()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)yajlrpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-12.0.4-4.el75.2-14.11.1RURkQ#@PP @On@NM@M PKKK?K@Daniel Mach - 2.0.4-4Daniel Mach - 2.0.4-3Fedora Release Engineering - 2.0.4-2Daniel P. Berrange - 2.0.4-1Fedora Release Engineering - 2.0.1-3Fedora Release Engineering - 2.0.1-2Daniel P. Berrange - 2.0.1-1Daniel P. Berrange - 1.0.12-1Daniel P. Berrange - 1.0.11-1Daniel P. Berrange - 1.0.7-3Daniel P. Berrange - 1.0.7-2Daniel P. Berrange - 1.0.7-1- Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Update to 2.0.4 release (rhbz #845777) - Fix License tag to reflect change in 2.0.0 series from BSD to ISC- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Update to 2.0.1 release- Update to 1.0.12 release- Update to 1.0.11 release- Fix ignoring of cflags (rhbz #547500)- Change use of 'define' to 'global'- Initial Fedora package 2.0.42.0.4-4.el72.0.4-4.el7yajlyajl_common.hyajl_gen.hyajlxxtXW6K$C?<?:d  d  )/8t     8t (d   (8w9 w:VwG5H5I6$X64Y6D\6p]6^7Sb7d8Pe8Uf8Xl8Zt8tu8v8w:x:Dy::::< < >?? ?0g?4h?8Clibpng-devel1.5.138.el7Development tools for programs to manipulate PNG image format filesThe libpng-devel package contains header files and documentation necessary for developing programs using the PNG (Portable Network Graphics) library. If you want to develop programs which will manipulate PNG image format files, you should install libpng-devel. You'll also need to install the libpng package._2x86-02.bsys.centos.orgLCentOSzlibCentOS BuildSystem Development/Librarieshttp://www.libpng.org/pub/png/linuxx86_64 mS5  A큤_0_0_0_0_0_0_0_0_0_0_0_0_0_0_0ae7bcca732d3d622f81647054410f74f0a48cedd1d7b22bd22fc80d4679a82b441e90d80f1ccb9786b88210029c2cd41411137d2844fa0ab8f75c5edf406691566f9cf23e9cccb8909cf8579b87d007c78e4607aea8ed914d0b177517a38539ca1dab16f59661b7c50011c26d30de6721e6da253d261227486f064b8a710283e19c996722a66f1a156de8afeb3748cc599f066f9fafd7fe5dec16172e7142ad59fa628df0a3c070a0f4653191b544f447e8a94a80bf7bacb0dbbd21f4d2af5c40363db9e080019d71c649286426c4afe4e32bd38a5c96ee90d7b170415ef5028libpng15-configlibpng15/png.hlibpng15/pngconf.hlibpng15/pnglibconf.hlibpng15.solibpng15.so.15.13.0libpng15.pcrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibpng-1.5.13-8.el7.src.rpmlibpng-devellibpng-devel(x86-64)pkgconfig(libpng)pkgconfig(libpng15)@@@    /bin/sh/usr/bin/pkg-configlibpng(x86-64)libpng15.so.15()(64bit)pkgconfig(x86-64)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)zlib-devel(x86-64)rpmlib(PayloadIsXz)2:1.5.13-8.el73.0.4-14.6.0-14.0-15.2-14.11.3]VO @VO @R@RURkQPd?PP@PO,@O\O@>܍>Z @>Z @>T@>1*>/@>.>%M@=z@=@<<< - 2:1.5.13-8Petr Hracek - 2:1.5.13-7Petr Hracek - 2:1.5.13-6Petr Hracek - 2:1.5.13-5Daniel Mach - 2:1.5.13-4Daniel Mach - 2:1.5.13-3Fedora Release Engineering - 2:1.5.13-2Tom Lane 2:1.5.13-1Tom Lane 2:1.5.12-1Tom Lane 2:1.5.10-3Fedora Release Engineering * patterns (#1206341) - fix PowerPC -mcrypto handling (#1200335) - Power8 unaligned vectorization improvements (#1199221, PR target/65456) - PRs ada/47500, ada/63225, bootstrap/64213, c++/56710, c++/58624, c++/63415, c++/63455, c++/64251, c++/64297, c++/64487, c++/65721, c++/65727, c/52769, c/61553, c/64766, debug/63342, debug/65549, fortran/56674, fortran/56867, fortran/57023, fortran/58813, fortran/59016, fortran/59024, fortran/59488, fortran/60898, fortran/61138, fortran/61407, fortran/63733, fortran/63744, fortran/63938, fortran/64244, fortran/64528, fortran/65024, gcov-profile/64634, inline-asm/63282, ipa/59626, ipa/63838, libfortran/63589, libgfortran/59513, libgfortran/60956, libgomp/61200, libstdc++/57440, libstdc++/59603, libstdc++/61947, libstdc++/63449, libstdc++/63840, libstdc++/65279, libstdc++/65543, lto/65015, lto/65193, middle-end/43631, middle-end/56917, middle-end/57748, middle-end/58624, middle-end/59990, middle-end/63608, middle-end/63665, middle-end/63704, middle-end/64067, middle-end/64111, middle-end/64199, middle-end/64225, middle-end/65409, middle-end/65680, middle-end/66133, middle-end/66251, pch/65550, preprocessor/60436, rtl-optimization/61058, rtl-optimization/63475, rtl-optimization/63483, rtl-optimization/63659, rtl-optimization/64037, rtl-optimization/64557, sanitizer/64265, target/49423, target/52941, target/53988, target/55351, target/56846, target/59593, target/60111, target/61413, target/62218, target/62642, target/63335, target/63428, target/63673, target/63947, target/64113, target/64115, target/6430xXSXW [$jorton@redhat.com> 5.2.0-6Joe Orton 5.2.0-5Joe Orton 5.2.0-4Joe Orton 5.2.0-3Joseph Orton 5.1.6-4Joe Orton 5.1.6-3Joe Orton 5.1.6-2Jesse Keating - 5.1.4-8.1Joe Orton 5.1.4-8Joe Orton 5.1.4-7Joe Orton 5.1.4-6Radek Vokal 5.1.4-5.1Joe Orton 5.1.4-5Joe Orton 5.1.4-3Joe Orton 5.1.3-3Joe Orton 5.1.2-5Jesse Keating - 5.1.2-4.3Jesse Keating - 5.1.2-4.1Joe Orton 5.1.2-4Joe Orton 5.1.2-3Joe Orton 5.1.2-2Joe Orton 5.1.1-8Joe Orton 5.1.1-7Joe Orton 5.1.1-6Jesse Keating Joe Orton 5.1.1-5Joe Orton 5.1.1-4Joe Orton 5.1.1-3Joe Orton 5.1.1-2Tomas Mraz 5.0.5-6Joe Orton 5.0.5-5Joe Orton 5.0.5-4Joe Orton 5.0.5-3Joe Orton 5.0.4-11Joe Orton 5.0.4-10Joe Orton 5.0.4-9Joe Orton 5.0.4-8Joe Orton 5.0.4-7Joe Orton 5.0.4-6Joe Orton 5.0.4-5Joe Orton 5.0.4-4Joe Orton 5.0.4-3Joe Orton 5.0.4-2Joe Orton 5.0.4-1Joe Orton 5.0.3-5Joe Orton 5.0.3-4Joe Orton 5.0.3-3Joe Orton 5.0.3-2Joe Orton 5.0.3-1Joe Orton 5.0.2-8Joe Orton 5.0.2-7Joe Orton 5.0.2-6Joe Orton 5.0.2-5Joe Orton 5.0.2-4Joe Orton 5.0.1-4Joe Orton 5.0.1-3Joe Orton 5.0.1-2Joe Orton 5.0.1-1Tom Callaway Tom Callaway - Fix filter bypass in filter_var FILTER_VALIDATE_URL CVE-2024-5458- use oracle client library version 21.13 - Fix __Host-/__Secure- cookie bypass due to partial CVE-2022-31629 fix CVE-2024-2756 - Fix password_verify can erroneously return true opening ATO risk CVE-2024-3096- Fix Security issue with external entity loading in XML without enabling it GHSA-3qrf-m4j2-pcrr CVE-2023-3823 - Fix Buffer mismanagement in phar_dir_read() GHSA-jqcx-ccgc-xwhv CVE-2023-3824 - move httpd/nginx wants directive to config files in /etc- fix possible buffer overflow in date - define %php56___phpize and %php56___phpconfig- Fix insufficient random bytes in HTTP Digest authentication for SOAP GHSA-76gg-c692-v2mw CVE-2023-3247 - use oracle client library version 21.10- fix #81744: Password_verify() always return true with some hash CVE-2023-0567 - fix #81746: 1-byte array overrun in common path resolve code CVE-2023-0568 - fix DOS vulnerability when parsing multipart request body CVE-2023-0662- pdo: fix #81740: PDO::quote() may return unquoted string CVE-2022-31631 - use oracle client library version 21.8- phar: fix #81726 DOS when using quine gzip file. CVE-2022-31628 - core: fix #81727 Don't mangle HTTP variable names that clash with ones that have a specific semantic meaning. CVE-2022-31629 - use oracle client library version 21.7- use oracle client library version 21.6 - mysqlnd: fix #81719: mysqlnd/pdo password buffer overflow. CVE-2022-31626 - pgsql: fix #81720: Uninitialized array in pg_query_params(). CVE-2022-31625- Fix #79971 special character is breaking the path in xml function CVE-2021-21707- fix PHP-FPM oob R/W in root process leading to priv escalation CVE-2021-21703 - use libicu version 69 - use oracle client lxBXiU`$7ure check - reduce to 4 concurrent test workers- update to 7.4.0RC1 - bump API number to 20190902- update to 7.4.0beta4- update to 7.4.0beta2- update to 7.4.0beta1 (new tag)- update to 7.4.0beta1 - main package now recommends commonly used extensions and SAPI (json, mbstring, opcache, pdo, xml) - fix gd build options and dependencies - refresh provided configuration from upstream production values- drop recode extension, moved to php-pecl-recode - add upstream patch for argon2 password- update to 7.4.0alpha3 - drop argon2 dependency using libsodium implementation- update to 7.4.0alpha2- use oracle client library version 19.3- add 3 upstream patches- update to 7.4.0alpha1- new snapshot - use pkgconfig dependencies for libxslt, libexslt, libsasl2, libargon2- new snapshot- new snapshot - bump ABI version - add patch for old unixODBC from https://github.com/php/php-src/pull/4203- new snapshot- new snapshot with configuration updated from upstream- new snapshot for enchant and sodium fix- new snapshot for sqlite3 fix- update to 7.4.0-dev - drop interbase extension and sub-package - move pdo_firebird extension in pdo-firebird sub-package - drop wddx extension - add ffi extension in new ffi sub-package - use pkgconfig dependencies for ext using PHP_CHECK_MODULE- update to 7.3.6RC1 (new tag)- update to 7.3.6RC1- test build for https://bugs.php.net/77653 patch from https://github.com/php/php-src/pull/4007- Update to 7.3.5 - http://www.php.net/releases/7_3_5.php- update to 7.3.5RC1- build with system oniguruma5- test build for https://bugs.php.net/77653 patch from https://github.com/php/php-src/pull/4007- Update to 7.3.4 - http://www.php.net/releases/7_3_4.php- update to 7.3.4RC1 new tag - add upstream patches for failed tests- update to 7.3.4RC1- Update to 7.3.3 - http://www.php.net/releases/7_3_3.php - add upstream patch for OpenSSL 1.1.1b- php-devel: drop dependency on libicu-devel- update to 7.3.3RC1 - adapt systzdata patch (v18)- pdo_oci: backport PDOStatement::getColumnMeta from 7.4- rebuild using libicu62- Update to 7.3.2 - http://www.php.net/releases/7_3_2.php- update to 7.3.2RC1 - update system tzdata patch for timelib 2018.01- cleanup for EL-8- test build for https://bugs.php.net/77430- Update to 7.3.1 - http://www.php.net/releases/7_3_1.php- update to 7.3.1RC1 - oci8 version is now 2.2.0- update to 7.3.0 GA - update FPM configuration from upstream- update to 7.3.0RC6- update to 7.3.0RC5- test build for https://github.com/php/php-src/pull/3652- update to 7.3.0RC4- update to 7.3.0RC3- update to 7.3.0RC2 - use oracle client library version 18.3- update to 7.3.0RC1 - with oniguruma 6.9.0- add upstream patch for openssl failing test- add upstream patch for F29- update to 7.3.0beta3- update to 7.3.0beta2 - bump API numbers- update to 7.3.0alpha4- update to 7.3.0alpha3- update to 7.3.0alpha2 new sources- update to 7.3.0alpha2 - bump php(zend-abi) and php(api) to 20180606 - revert 5dd1ef90caec3021e6ce55c8554e695edf641eaf- update to 7.3.0alpha1 - switch from pcre to pcre2- update to 7.2.7RC1- Update to 7.2.6 - http://www.php.net/releases/7_2_6.php- rebuild against EL 7.5- update to 7.2.6RC1- Update to 7.2.5 - http://www.php.net/releases/7_2_5.php- update to 7.2.5RC1- add upstream patch for oniguruma 6.8.1, FTBFS #1562583- Update to 7.2.4 - http://www.php.net/releases/7_2_4.php - FPM: update default pool configuration for process.dumpable- add file trigger to restart the php-fpm service when new pool or new extension installed (F27+)- update to 7.2.4RC1- devel: drop dependency on devtoolset- Update to 7.2.3 - http://www.php.net/releases/7_2_3.php - FPM: revert pid file removal - improve devel dependencies- rebuild for new tag and drop patch merged upstream - drop ldconfig scriptlets on F28- update to 7.2.3RC1 - adapt systzdata, fixheader and ldap_r patches - apply upstream patch for date ext- Update to 7.2.2 - http://www.php.net/releases/7_2_2.php- update to 7.2.2RC1 - define SOURCE_DATE_EPOCH for reproducible build- Updax82X1Wa$Baaaörn Esser - 1:0.2.999-15.20170308git8e6e102Björn Esser - 1:0.2.999-14.20170308git8e6e102Simone Caronni - 1:0.2.999-13.20170308git8e6e102Simone Caronni - 1:0.2.999-12.20170308git8e6e102Nicolas Chauvet - 1:0.2.999-11.gitdc16f8cHans de Goede - 1:0.2.999-10.gitdc16f8cHans de Goede - 1:0.2.999-9.gitdc16f8cHans de Goede - 1:0.2.999-8.gitdc16f8cHans de Goede - 1:0.2.999-7.gitdc16f8cAdam Jackson Leigh Scott - 0.2.999-6.git28867bbLeigh Scott - 0.2.999-5.git295e5e5Nicolas Chauvet - 0.2.999-4.git295e5e5Adam Jackson - 0.2.999-3.git14f6283Nicolas Chauvet - 0.2.999-2.git14f6283Nicolas Chauvet - 0.2.999-1.git14f6283Nicolas Chauvet - 0.1.1-2.gitf7fbc4bNicolas Chauvet - 0.1.1-1.gitf7fbc4bNicolas Chauvet - 0.1.0-4.git093f048Nicolas Chauvet - 0.1.0-3.gita82982dNicolas Chauvet - 0.1.0-2.git509de0dNicolas Chauvet - 0.1.0-1.git8277115Nicolas Chauvet - 0.0.0-9.git4d977eaNicolas Chauvet - 0.0.0-8git20160217Nicolas Chauvet - 0.0.0-7git20160115Nicolas Chauvet - 0.0.0-6git20160106Nicolas Chauvet - 0.0.0-5git20151121Nicolas Chauvet - 0.0.0-4git20151110Nicolas Chauvet - 0.0.0-3git20150901Nicolas Chauvet - 0.0.0-2Nicolas Chauvet - 0.0.0-1- rename fallback from fedora to system- Add another fallback GLX library name- Enable %check for all but ppc64 and s390x, which has known but low-impact failures - Simplify %release- Go back to Requires: mesa-*, the fallout is too great (#1568881 etc)- Update snapshot to 20180327- Use Recommends: mesa-* not Requires. - (Trivially) switch the build to python3- Update Python 2 dependency declarations to new packaging standards (See https://fedoraproject.org/wiki/FinalizingFedoraSwitchtoPython3)- Update snapshot to 20180226 - Update scriptlets- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Update to 1.0.0 release- Update snapshot to 20170818- Own %{_sysconfdir}/egl and %{_datadir}/egl dirs- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Binutils_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Rebuild due to bug in RPM (RHBZ #1468476)- Update snapshot to 20170620- Update snapshot to 20170607 - Default to asm and tls when available - Use the fixed tsd for armhfp and aarch64 fixed in https://github.com/NVIDIA/libglvnd/issues/116- Add conditional to disable testsuite, when needed- Rebuilt with testsuite again- Rebuilt without testssuite- Fix conditionals for _without_mesa_glvnd_default - Fix other RHEL-conditionals, too- Update RPM filters for private libraries (includes GLX, fixes RHEL 6).- Update to latest snapshot, remove upstreamed patches. - Update release to packaging guidelines format. - Make sure that for Fedora 24 and RHEL the libraries are always private.- asm enabled only for x86 - rhbz#1419944- Drop 0007-GLX-Add-GLX_SGIX_fbconfig-functions.patch the bug this works around actually is in mesa- Add eglexternalplatform spec. config dirs to -egl subpackage (rhbz#1415143)- Fix GLX_SGIX_fbconfig extension, this fixes games such as "The Binding of Isaac: Rebirth" and "Crypt of the NecroDancer" from Steam not working- Epoch:1 to provide upgrade path from negativo17.org rpms - New snapshot - Add patches to fix building on ARM (from Rob Clark) - Add BuildRequires: python - Add ldconfig scriptlets for library sub-packages- Don't hide libraries in a subdir (rhbz#1413579) - Split up libraries to appropriate subpackx!XA`XeT$bTT"2394529fbf054ef1cd4921bbhomedircon as semanage_exec_t Resolves: #219421 - Allow sysadm_lpr_t to manage other print spool jobs Resolves: #220080- allow automount to setgid Resolves: #219999- Allow cron to polyinstatiate - Fix creation of boot flags Resolves: #207433- Fixes for irqbalance Resolves: #219606- Fix vixie-cron to work on mls Resolves: #207433Resolves: #218978- Allow initrc to create files in /var directories Resolves: #219227- More fixes for MLS Resolves: #181566- More Fixes polyinstatiation Resolves: #216184- More Fixes polyinstatiation - Fix handling of keyrings Resolves: #216184- Fix polyinstatiation - Fix pcscd handling of terminal Resolves: #218149 Resolves: #218350- More fixes for quota Resolves: #212957- ncsd needs to use avahi sockets Resolves: #217640 Resolves: #218014- Allow login programs to polyinstatiate homedirs Resolves: #216184 - Allow quotacheck to create database files Resolves: #212957- Dontaudit appending hal_var_lib files Resolves: #217452 Resolves: #217571 Resolves: #217611 Resolves: #217640 Resolves: #217725- Fix context for helix players file_context #216942- Fix load_policy to be able to mls_write_down so it can talk to the terminal- Fixes for hwclock, clamav, ftp- Move to upstream version which accepted my patches- Fixes for nvidia driver- Allow semanage to signal mcstrans- Update to upstream- Allow modstorage to edit /etc/fstab file- Fix for qemu, /dev/- Fix path to realplayer.bin- Allow xen to connect to xen port- Allow cups to search samba_etc_t directory - Allow xend_t to list auto_mountpoints- Allow xen to search automount- Fix spec of jre files- Fix unconfined access to shadow file- Allow xend to create files in xen_image_t directories- Fixes for /var/lib/hal- Remove ability for sysadm_t to look at audit.log- Fix rpc_port_types - Add aide policy for mls- Merge with upstream- Lots of fixes for ricci- Allow xen to read/write fixed devices with a boolean - Allow apache to search /var/log- Fix policygentool specfile problem. - Allow apache to send signals to it's logging helpers. - Resolves: rhbz#212731- Add perms for swat- Add perms for swat- Allow daemons to dump core files to /- Fixes for ricci- Allow mount.nfs to work- Allow ricci-modstorage to look at lvm_etc_t- Fixes for ricci using saslauthd- Allow mountpoint on home_dir_t and home_t- Update xen to read nfs files- Allow noxattrfs to associate with other noxattrfs- Allow hal to use power_device_t- Allow procemail to look at autofs_t - Allow xen_image_t to work as a fixed device- Refupdate from upstream- Add lots of fixes for mls cups- Lots of fixes for ricci- Fix number of cats- Update to upstream- More iSCSI changes for #209854- Test ISCSI fixes for #209854- allow semodule to rmdir selinux_config_t dir- Fix boot_runtime_t problem on ppc. Should not be creating these files.- Fix context mounts on reboot - Fix ccs creation of directory in /var/log- Update for tallylog- Allow xend to rewrite dhcp conf files - Allow mgetty sys_admin capability- Make xentapctrl work- Don't transition unconfined_t to bootloader_t - Fix label in /dev/xen/blktap- Patch for labeled networking- Fix crond handling for mls- Update to upstream- Remove bluetooth-helper transition - Add selinux_validate for semanage - Require new version of libsemanage- Fix prelink- Fix rhgb- Fix setrans handling on MLS and useradd- Support for fuse - fix vigr- Fix dovecot, amanda - Fix mls- Allow java execheap for itanium- Update with upstream- mls fixes- Update from upstream- More fixes for mls - Revert change on automount transition to mount- Fix cron jobs to run under the correct context- Fixes to make pppd work- Multiple policy fixes - Change max categories to 1023- Fix transition on mcstransd- Add /dev/em8300 defs- Upgrade to upstream- Fix ppp connections from network manager- Add tty access to all domains boolean - Fix gnome-pty-helper context for ia64- Fixed typealias of firstboot_rw_t- Fix location of xel log files - Fix handling of sysadm_r xXX2Wa$Caaages - Make the req/prov filter catch more cases - Restore libGLESv1 for ABI compliance- Update snapshot - Fix EGL crash for KDE/Plasma (rfbz#4303)- Fix EGL crash (rfbz#4303)- Update snapshot- Restore hardened build - Remove ExclusiveArch - Remove some pointless Provides/Obsoletes - BuildRequires pkgconfig(xext) not pkgconfig(xv) - Update description to be a bit more confident - Dump make check errors into the build log- Add the correct License: MIT- Update to 2.999 version - Add EGL- Update license - Fix Obsoletes/Provides to avoid self obsolete- Update to 1.1.gitf7fbc4b- Update to 20160610 git commit- Update to current snapshot- Update to current snapshot - Remove unused dt-auxiliary - Add support for graphical make test - Undefine hardened build for xorg- Update to lastest snapshot- Remove patch to enable by default- Update to git20160217 - Introduce --with mesa-libglvnd-default build conditional - Avoid error on make check - testglxqueryversion.sh stil fails in mock - Filter on provided libGL until glvnd support is in upstream mesa - Use upstream tarball and use autoreconf- Bump for 20160115 - Enable make check - Description improvements - Enable libglvnd by default - Enable devel sub-package- Update to 20160106 snapshot - Remove 10-x11glvnd- Update to 20151121 snapshot - Avoid conflicts with mesa-libGL{,ES} - Disable libGLESv1_CM- Update to today snapshot - Fix license- Update to snapshot 20150901- Update to today snapshoot- Initial spec file/sbin/ldconfig/sbin/ldconfig1:1.0.1-0.8.git5baa1e5.el71:1.0.1-0.8.git5baa1e5.el7eglegl_external_platform.degl_vendor.dlibEGL.so.1libEGL.so.1.1.0eglegl_external_platform.degl_vendor.d/etc//etc/egl//etc/glvnd//usr/lib64//usr/share//usr/share/egl//usr/share/glvnd/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnudirectoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4935ec9bd3bb144f3a3b9df2e6b5e703709e70ea, strippedPRR RR RRRRR RR RRR?P0[$ƨi!zA bBsc#7c,V=5KbZyS ƵǰAKd/[Ӣ?fZow#5@) [ b!3IڋvO%߰ߪ痠(8soMjO@ D<9 /̶K:z;t _=6{šlQY Ʉ4VR`iM?rf )<4C˖_A~ ?`9&'bJ8qʉ 0xRr!-po5 :6sgZHPj?Ts|>P?9ݹZކ~nXM _HT$m R!(2iRƺoåS@NsB(hui*`L:JTkW-Q,A V=T'd!x_J6Ul"xhm L#T+„:^zvapTٻa`=x|dE_aQߑI;g[$ƨXfHI"vOAijq#Zr%=06k" \;<<8Ƅ?y:|luX8;t)q .v[Dg+es44H1jb|ݷ, ˴ VeڷӜ6q>5($](!ǂ- "/7V [Y$' C6˻$̷szՀ1-vl2nG=i!lPx;֚Yɿ'8l\i GWM3ܱ_4gNz91J{gr5썡/_~4Äc>θŕ"zm@9}De64@(ZKǬP~nesWq_u'/]'r2b:I}RDBѰLfm˜diɐsN\O(lm'Bs<#K ~xT W|\˄'/DYH 5+s(pee358250eaac0b7fc1618cbae45b7c7b5d0290fbbMXb: VERDE_me.bin9 VERDE_mc2.bin8 VERDE_mc.bin7 VERDE_ce.bin.baV61.plsmcb<V60.plRDEbdV52.plVbnV51.plb.V50.pl9bEV41.pldbVV40.plinbV32.plce.b$V31.pllinbdV30.plWbV21.pl bvV20.plbvV11.pl8oo]oUzhgorodxXW> $hn exif_process_SOFn CVE-2019-9640 Fix #77563 Uninitialized read in exif_process_IFD_in_MAKERNOTE CVE-2019-9638 Fix #77659 Uninitialized read in exif_process_IFD_in_MAKERNOTE CVE-2019-9639- cleanup for EL-8- Update to 5.6.40 - http://www.php.net/releases/5_6_40.php- Update to 5.6.39 - http://www.php.net/releases/5_6_39.php- use oracle client library version 18.3- Update to 5.6.38 - http://www.php.net/releases/5_6_38.php- F29: backport ICU 62.1 support from 7.1- Update to 5.6.37 - http://www.php.net/releases/5_6_37.php- Update to 5.6.36 - http://www.php.net/releases/5_6_36.php- Update to 5.6.35 - http://www.php.net/releases/5_6_35.php - FPM: update default pool configuration for process.dumpable- add file trigger to restart the php-fpm service when new pool or new extension installed (F27+)- Update to 5.6.34 - http://www.php.net/releases/5_6_34.php - FPM: revert pid file removal - improve devel dependencies- Update to 5.6.33 - http://www.php.net/releases/5_6_33.php- Update to 5.6.32 - http://www.php.net/releases/5_6_32.php- F27: php now requires php-fpm and start it with httpd / nginx- disable httpd MPM check- refresh openssl 1.1 patch for F26- Update to 5.6.31 - http://www.php.net/releases/5_6_31.php - use oracle instant client version 12.2- add patch for tests with tzdata 2017.1- add patch for firebird configuration - add patch for OpenSSL 1.1 on F26- disable dtrace by default, this may be enabled again using environment variable USE_ZEND_DTRACE=1, backported from PHP 7- Update to 5.6.30 - http://www.php.net/releases/5_6_30.php- update to 5.6.30RC1- Update to 5.6.29 - http://www.php.net/releases/5_6_29.php- update to 5.6.29RC1- Update to 5.6.28 - http://www.php.net/releases/5_6_28.php- update to 5.6.28RC1- Update to 5.6.27 - http://www.php.net/releases/5_6_27.php- update to 5.6.27RC1- Update to 5.6.26 - http://www.php.net/releases/5_6_26.php- update to 5.6.26RC1 - oci8 version is now 2.0.12- Update to 5.6.25 - http://www.php.net/releases/5_6_25.php- update to 5.6.25RC1- Update to 5.6.24 - http://www.php.net/releases/5_6_24.php- update to 5.6.24RC1- own tests/doc directories for pecl packages (f24)- Update to 5.6.23 - http://www.php.net/releases/5_6_23.php- update to 5.6.23RC1- Update to 5.6.22 - http://www.php.net/releases/5_6_22.php- update to 5.6.22RC1- Update to 5.6.21 http://www.php.net/releases/5_6_21.php- update to 5.6.21RC1 - bump oci8 version to 2.0.11- Update to 5.6.20 http://www.php.net/releases/5_6_20.php- update to 5.6.20RC1- adapt for F24: define %pecl_xmldir and own it- Update to 5.6.19 http://www.php.net/releases/5_6_19.php- update to 5.6.19RC1- Update to 5.6.18 http://www.php.net/releases/5_6_18.php- FPM: test build for https://bugs.php.net/62172- update to 5.6.18RC1- Update to 5.6.17 http://www.php.net/releases/5_6_17.php - curl: add CURL_SSLVERSION_TLSv1_x constants - fpm: switch to UDS on Fedora >= 21- update to 5.6.17RC1- Update to 5.6.16 http://www.php.net/releases/5_6_16.php- update to 5.6.16RC1- Update to 5.6.15 http://www.php.net/releases/5_6_15.php - php-config: reports all built sapis- update to 5.6.15RC1- Update to 5.6.14 http://www.php.net/releases/5_6_14.php - php-fpm: enable http authorization headers- update to 5.6.14RC1- Update to 5.6.13 http://www.php.net/releases/5_6_13.php- Update to 5.6.12 http://www.php.net/releases/5_6_12.php- update to 5.6.12RC1- Update to 5.6.11 http://www.php.net/releases/5_6_11.php- update to 5.6.11RC1 - the phar link is now correctly created- Update to 5.6.10 http://www.php.net/releases/5_6_10.php- update to 5.6.10RC1 - opcache is now 7.0.6-dev- Update to 5.6.9 http://www.php.net/releases/5_6_9.php- update to 5.6.9RC1- test build (new zic)- Update to 5.6.8 http://www.php.net/releases/5_6_8.php- add upstream patch to drop SSLv3 tests- update to 5.6.8RC1- Update to 5.6.7 http://www.php.net/releases/5_6_7.php- update to 5.6.7RC1- Update to 5.6.6 http://www.php.net/releases/5_6_6.php- Update to 5.6.5 http://www.php.net/rx7     @&  UȦZ Providename@xx@8XUt<$ <<<9a5eaef45caebd371c554e3e192f981ecc1b8117038f06129c9a63cfd181343dcfe75ef45caebd371c554e3e192f981ecc1b8117038f06129c9a63cfd181343dcfe7532c2795cfd37c5f10a110d19db46edab1c1e220181b6b2906467f70f8063743d32c2795cfd37c5f10a110d19db46edab1c1e220181b6b2906467f70f8063743dc844d04469b999997a00b129f5a3c13c11297fb596ad8a46a46ea2a4406939a1c844d04469b999997a00b129f5a3c13c11297fb596ad8a46a46ea2a4406939a16f8150e760134d66de3ffaed7bf14464c12353f9ab42d9cb70a41ac98986bb506f8150e760134d66de3ffaed7bf14464c12353f9ab42d9cb70a41ac98986bb50669414ba9713b747a896878b02164fce2420dda8168e48c734c8da0ab364b2c2669414ba9713b747a896878b02164fce2420dda8168e48c734c8da0ab364b2c2585101ce02b0b36c9125b9270616cc8013a6dd8bccac86b9f9190c89b475ff68585101ce02b0b36c9125b9270616cc8013a6dd8bccac86b9f9190c89b475ff689c03cdc19126030332ff0d571646c2da093751c07a4e91a03a560015df828f179c03cdc19126030332ff0d571646c2da093751c07a4e91a03a560015df828f179b9311b58d07d74af07949f625650684faeae125813178a8279b6a3e57d7c2799b9311b58d07d74af07949f625650684faeae125813178a8279b6a3e57d7c2797e825a1a99c90fefd3917c8a1afded07fc4e74491bb6015385fa216b4d858ed37e825a1a99c90fefd3917c8a1afded07fc4e74491bb6015385fa216b4d858ed300b326252475c41b6872da0598bce3a1eb9f02cd424ed1605284db193a472c8100b326252475c41b6872da0598bce3a1eb9f02cd424ed1605284db193a472c81c4acda5db39c652826fa38685830e8a96bc7a07bdde69008f7d8d3427353e2b9c4acda5db39c652826fa38685830e8a96bc7a07bdde69008f7d8d3427353e2b9b9bc685e3f41b1050ee267ed5bd1e3a5108fb607970d7b9da4f94d227b5905d2b9bc685e3f41b1050ee267ed5bd1e3a5108fb607970d7b9da4f94d227b5905d27d8856e30be1e1e26249c58e84e7a5986371a5fa5fa35cc85db8f2ae66d015527d8856e30be1e1e26249c58e84e7a5986371a5fa5fa35cc85db8f2ae66d0155267bcaaceb0a837d482eccbfc9e7be64c96f90dd4e25250c65b9b993a3731b71b67bcaaceb0a837d482eccbfc9e7be64c96f90dd4e25250c65b9b993a3731b71b9ffef23e5bf8157e72a62a163a571c04dd170bd0a3aa3bba1e9790652a7fe3de9ffef23e5bf8157e72a62a163a571c04dd170bd0a3aa3bba1e9790652a7fe3decb3c48d267fca135cf55528fc1eb76a8f23d3ed18f06f597b7e7949d9192a211cb3c48d267fca135cf55528fc1eb76a8f23d3ed18f06f597b7e7949d9192a211a9f29dfc36fbaa6ea150cff2deee78f8eaa477975ac392a69fb8ccabb8901981a9f29dfc36fbaa6ea150cff2deee78f8eaa477975ac392a69fb8ccabb8901981f1224c33117caed54cc6f8d0a4612e44aee67b16f2cbcf7271cab82fa59f2308f1224c33117caed54cc6f8d0a4612e44aee67b16f2cbcf7271cab82fa59f23088bd912dcbf01fbfe711b525eac425b26f8cfa48456a10d6c8950a41c95d50c2d8bd912dcbf01fbfe711b525eac425b26f8cfa48456a10d6c8950a41c95d50c2d5222d4af8fb2b23a77e07c39d2588a83cd9dcb06aecc44f7605ae9a8c09efe545222d4af8fb2b23a77e07c39d2588a83cd9dcb06aecc44f7605ae9a8c09efe54c78e1287cdafdf174b93658475be48087eb7836e741fd80e37aea4d9b031f1cac78e1287cdafdf174b93658475be48087eb7836e741fd80e37aea4d9b031f1ca5cead4dd8e02348ef97eb149af3a0c5570adaacd5ae995118400a0b05ec973135cead4dd8e02348ef97eb149af3a0c5570adaacd5ae995118400a0b05ec97313f8de336e360b9c756d59c391ea225ca26e93bc9e6e387d24524878bd370931b6f8de336e360b9c756d59c391ea225ca26e93bc9e6e387d24524878bd370931b6b9d0efdbff01fa38d96a27d09129505ac296dbd70143be9ee78fafb99e3497d1b9d0efdbff01fa38d96a27d09129505ac296dbd70143be9ee78fafb99e3497d1ce68da02faa42e424d0513286a65a3649e4fcbfad47c49c8a0867e613bffd79bce68da02faa42e424d0513286a65a3649e4fcbfad47c49c8a0867e613bffd79b3b182c61f3601bebbfe1238fff5a1c3693769ec9b774da11da3a8554478202e73b182c61f3601bebbfe1238fff5a1c3693769ec9b774da11da3a8554478202e78447cbc60282e1363a63bc41ea3a606c94057cef56b013ba9ad48b970f5b8a728447cbc60282e1363a63bc41ea3a606c94057cef56b013ba9ad48b970f5b8a726cedda3ae14df0fc6893a4ed20e62a2d997fa55131142279bf022c030185731f6cedda3ae14df0fc6893a4ed20e62a2d997fa55131142279bf022c030185731f70271c25ae4da6c64293fff464108e8b73e4691c2a540a2ab9e8bf30f1611b9e70271c25ae4da6c64293fff464108e8b73e4691c2a540a2ab9e8bf30f1611b9e972c34ed0369a635d43b576a140eed72ad95559d3db441dbf237dde79a058343972c34ed0369a635d43b576a140eed72ad95559d3db441dbf237dde79a058343830a2d9301fe38ebc9930641c5228c9483c688c6ea59ede1023fa40a7234eac0830a2d9301fe38ebc9930641c5228c9483c688c6ea59ede1023fa40a7234eac0520xXHV0 8ZG$JZGYG=HX?Cd $ ( `@D\`gk $ H l    z@\%% %( P8 X!9!:{!G?H?I@X@$Y@,\@`]@^A bBdCeCfClCCCCE E H H4H8HLgHPhHTCdhclient4.2.583.el7.centos.2 Provides the ISC DHCP client daemon and dhclient-scriptDHCP (Dynamic Host Configuration Protocol) is a protocol which allows individual devices on an IP network to get their own network configuration information (IP address, subnetmask, broadcast address, etc.) from a DHCP server. The overall purpose of DHCP is to make it easier to administer a large network. To use DHCP on your network, install a DHCP service (or relay agent), and on clients run a DHCP client daemon. The dhclient package provides the ISC DHCP client daemon.fh`x86-02.bsys.centos.orgjwCentOSISCCentOS BuildSystem System Environment/Basehttp://isc.org/products/DHCP/linuxx86_64cRyXy,~'XGAAA큤AA큤Afh`fh`a_ 8.13.2-1Jeff Johnson 8.13.1-2.2Thomas Woerner 8.13.1-2.1Thomas Woerner 8.13.1-2Thomas Woerner 8.13.1-1Thomas Woerner 8.13.0-1.1Thomas Woerner 8.13.0-1Elliot Lee Dan Walsh 8.12.11-4.6Dan Walsh 8.12.11-4.5Thomas Woerner 8.12.11-4.4Thomas Woerner 8.12.11-4.3Thomas Woerner 8.12.11-4.2Thomas Woerner 8.12.11-4.1Thomas Woerner 8.12.11-4Elliot Lee Thomas Woerner 8.12.11-3.2Thomas Woerner 8.12.11-3Thomas Woerner 8.12.11-2.1Thomas Woerner 8.12.11-2Thomas Woerner 8.12.11-1.3Thomas Woerner 8.12.11-1.2Thomas Woerner 8.12.11-1.1Thomas Woerner 8.12.11-1Thomas Woerner 8.12.10-7Thomas Woerner 8.12.10-6Florian La Roche Jeff Johnson 8.12.10-5Florian La Roche Karsten Hopp 8.12.10-3Karsten Hopp Florian La Roche Harald Hoyer 8.12.10-2Jeff Johnson 8.12.10-1.2Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Elliot Lee Florian La Roche Florian La Roche Nalin Dahyabhai 8.12.9-6Nalin Dahyabhai 8.12.9-5Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Elliot Lee Elliot Lee Florian La Roche Florian La Roche Tim Powers Florian La Roche Florian La Roche Florian La Roche Florian La Roche Nalin Dahyabhai Florian La Roche Florian La Roche Florian La Roche Nalin Dahyabhai Florian La Roche Florian La Roche Phil Knirsch 8.12.5-7.2Than Ngo 8.12.5-7.1Florian La Roche Phil Knirsch Phil Knirsch Florian La Roche Florian La Roche Florian La Roche Florian La Roche Tim Powers Florian La Roche Tim Powers Florian La Roche Tim Powers Florian La Roche Florian La Roche Bill Nottingham Florian La Roche Florian La Roche Bill Nottingham 8.12.2-5Bill Nottingham 8.12.2-3Nalin Dahyabhai 8.12.2-2Nalin Dahyabhai 8.12.2-1Florian La Roche Bill Nottingham 8.11.6-12Bill Nottingham 8.11.6-11Bernhard Rosenkraenzer 8.11.6-10FloxXW$btune=genericcpioxz2x86_64-redhat-linux-gnuhttps://forum.remirepo.net/?Pz8 kInՈ]!LΈJ]NoGVf`( NoGVW:!tiPG1}J who:l}TOeD"]!LΈJ]NoGVf`( NoGVwLbCPVSYuh7!+lǗu9'7s5bf11b89fa143f2778b636a3249f030722e3f5cb2g v+D@g us to initialization (Myron Stowe) [1331507] - [pci] pciehp: Handle surprise add even if surprise removal isn't supported (Myron Stowe) [1331507] - [pci] pci/aspm: Use standard parsing functions for sysfs setters (Myron Stowe) [1331507] - [pci] Delete unnecessary NULL pointer checks (Myron Stowe) [1331507] - [pci] Prevent out of bounds access in numa_node override (Myron Stowe) [1331488] - [pci] Prevent out of bounds access in numa_node override (Myron Stowe) [1331488] - [pci] Remove unused and broken to_hotplug_slot() (Myron Stowe) [1331488] - [pci] Make FLR and AF FLR reset warning messages different (Myron Stowe) [1331488] - [pci] Simplify if-return sequences (Myron Stowe) [1331488] - [pci] Delete unnecessary NULL pointer checks (Myron Stowe) [1331488] - [pci] Allow numa_node override via sysfs (Myron Stowe) [1331488] - [x86] mm: pat: Avoid truncation when converting cpa->numpages to address (Larry Woodman) [1328755] - [fs] gfs2: Use gfs2 wrapper to sync inode before calling generic_file_splice_read() (Abhijith Das) [1331071] - [fs] lockd: create NSM handles per net namespace ("J. Bruce Fields") [1328938] - [fs] lockd: NLM grace period shouldn't block NFSv4 opens ("J. Bruce Fields") [1328938] - [fs] ext4: rate limit printk in buffer_io_error() (Carlos Maiolino) [1142771] - [fs] clarify rate limit suppressed buffer I/O errors (Carlos Maiolino) [1142771] - [fs] merge I/O error prints into one line (Carlos Maiolino) [1142771] - [fs] block: Remove annoying "unknown partition table" message (Carlos Maiolino) [1142771] - [fs] ovl: Ensure upper filesystem supports d_type (Vivek Goyal) [1288162] - [fs] epoll: restrict EPOLLEXCLUSIVE to POLLIN and POLLOUT (Hannes Frederic Sowa) [1245628] - [fs] epoll: add EPOLLEXCLUSIVE flag (Hannes Frederic Sowa) [1245628] - [fs] pipe: limit the per-user amount of pages allocated in pipes (Mateusz Guzik) [1313960] {CVE-2016-2847} - [sound] alsa: usb-audio: avoid freeing umidi object twice (Mateusz Guzik) [1310663] {CVE-2016-2384} - [netdrv] atl2: Disable unimplemented scatter/gather feature (Mateusz Guzik) [1320106] {CVE-2016-2117} - [misc] cxl: Configure the PSL for two CAPI ports on POWER8NVL (Steve Best) [1278793] - [powerpc] Define PVR value for POWER8NVL processor (Steve Best) [1278793] - [powerpc] powernv: Silence SYSPARAM warning on boot (Steve Best) [1331179] - [infiniband] hfi1: Move hfi1 driver to match upstream tree (Alex Estrin) [1328249]- [tools] power turbostat: intel xeon x200: fix erroneous bclk value (Steve Best) [1330164] - [tools] power turbostat: intel xeon x200: fix turbo-ratio decoding (Steve Best) [1330167] - [x86] kvm: vmx: disable PEBS before a guest entry (Radim Krcmar) [1272097] - [net] netfilter: x_tables: introduce and use xt_copy_counters_from_user (Florian Westphal) [1318693] {CVE-2016-3134} - [net] netfilter: x_tables: do compat validation via translate_table (Florian Westphal) [1318693] {CVE-2016-3134} - [net] netfilter: x_tables: xt_compat_match_from_user doesn't need a retval (Florian Westphal) [1318693] {CVE-2016-3134} - [net] netfilter: arp_tables: simplify translate_compat_table args (Florian Westphal) [1318693] {CVE-2016-3134} - [net] netfilter: ip6_tables: simplify translate_compat_table args (Florian Westphal) [1318693] {CVE-2016-3134} - [net] netfilter: ip_tables: simplify translate_compat_table args (Florian Westphal) [1318693] {CVE-2016-3134} - [net] netfilter: remove unused comefrom hookmask argument (Florian Westphal) [1318693] {CVE-2016-3134} - [net] netfilter: x_tables: validate all offsets and sizes in a rule (Florian Westphal) [1318693] {CVE-2016-3134} - [net] netfilter: x_tables: check for bogus target offset (Florian Westphal) [1318693] xxQønȫ@XW+Dc$TDcCcEcmodir - improve system libzip patch to use pkg-config - use _httpd_contentdir macro and fix php.gif path - switch back to upstream generated scanner/parser - use system pcre only when recent enough- improves php.conf, no need to be relocated- clarify Licenses - missing provides xmlreader and xmlwriter - change php embedded library soname version to 5.4- fix mysql_sock macro definition- fix standard build (non scl)- fix installed headers- use libldap_r for ldap extension- add missing scl_prefix in some provides/requires- make php-enchant optionnal, not available on RHEL-5 - make php-recode optionnal, not available on RHEL-5 - disable t1lib on RHEL-5- enable tidy on RHEL-6 only - re-enable unit tests- minor macro fixes for RHEL-5 build - update autotools workaround for RHEL-5 - use readline when libedit not available (RHEL-5)- update to 5.4.8 - define both session.save_handler and session.save_path - fix possible segfault in libxml (#828526) - use SKIP_ONLINE_TEST during make test - php-devel requires pcre-devel and php-cli (instead of php) - provides php-phar - update systzdata patch to v10, timezone are case insensitive- php-fpm: create apache user if needed - php-cli: provides cli command in standard root (scl)- add configtest option to init script - test configuration before service reload - fix php-fpm service relocation - fix php-fpm config relocation - drop embdded subpackage for scl- missing requires on scl-runtime - relocate /var/lib/session - fix php-devel requires - rename, but don't relocate macros.php- initial spec rewrite for scl build- fix typo in systemd macro- php-fpm: enable PrivateTmp - php-fpm: new systemd macros (#850268) - php-fpm: add upstream patch for startup issue (#846858)- systemd integration, https://bugs.php.net/63085 - no odbc call during timeout, https://bugs.php.net/63171 - check sqlite3_column_table_name, https://bugs.php.net/63149- most failed tests explained (i386, x86_64)- fix for http://bugs.php.net/63126 (#783967)- patch to ensure we use latest libdb (not libdb4)- really fix rhel tests (use libzip and libdb)- fix test to enable zip extension on RHEL-7- remove session.save_path from php.ini move it to apache and php-fpm configuration files- update to 5.4.7 http://www.php.net/releases/5_4_7.php - php-fpm: don't daemonize- enable php-fpm on secondary arch (#849490)- update to 5.4.6 - update to v9 of systzdata patch - backport fix for new libxml- update to 5.4.5- also provide php(language)%{_isa} - define %{php_version}- drop BR for libevent (#835671) - provide php(language) to allow version check- add missing provides (core, ereg, filter, standard)- update to 5.4.4 (CVE-2012-2143, CVE-2012-2386) - use /usr/lib/tmpfiles.d instead of /etc/tmpfiles.d - use /run/php-fpm instead of /var/run/php-fpm- update to 5.4.3 (CVE-2012-2311, CVE-2012-2329)- update to 5.4.2 (CVE-2012-1823)- update to 5.4.1- rebuild for new icu - switch (conditionally) to libdb-devel- fix Loadmodule with MPM event (use ZTS if not MPM worker) - split conf.d/php.conf + conf.modules.d/10-php.conf with httpd 2.4- rebuild for missing automatic provides (#807889)- really use _httpd_mmn- rebuild against httpd 2.4 - use _httpd_mmn, _httpd_apxs macros- update to PHP 5.4.0 finale- update to PHP 5.4.0RC8- update to PHP 5.4.0RC7 - provides env file for php-fpm (#784770) - add patch to use system libzip (thanks to spot) - don't provide INSTALL file- all binaries in /usr/bin with zts prefix- update to PHP 5.4.0RC6 https://fedoraproject.org/wiki/Features/Php54- fix systemd unit- switch to systemd- Rebuild for new libpng- rebuild with new gmp without compat lib- rebuild with new gmp- revert is_a() to php <= 5.3.6 behavior (from upstream) with new option (allow_string) for new behavior- add mysqlnd sub-package - drop patch4, use --libdir to use /usr/lib*/php/build - add patch to redirect mysql.sock (in mysqlnd)- update to 5.3.8 http://www.php.net/ChangeLog-5.php#5.3.8- update to 5.3.7 http://www.php.net/ChangeLog-5.php#5.3.7 - merge php-zts into phxXcV@(!$=BFL?Ad  > !'066 t6 6 6 .6 d6<6J6X|6T\(8/9t/:!/G3l6H4D6I56X5TY5\6 6]66^9b:d;Ge;Lf;Ol;Qt;l6u,6x?6y?iAAAC C EFF6F@gFDhFHCperl-MailTools2.122.el7Various mail-related perl modulesMailTools is a set of Perl modules related to mail applications.SIworker1.bsys.centos.orgOCentOSGPL+ or ArtisticCentOS BuildSystem Development/Librarieshttp://search.cpan.org/dist/MailTools/linuxnoarchu ]3   R A|) k mO  8.z)z4nY $ BA큤A큤A큤A큤A큤SHPEPEPESESEPESESESGSGSFSFSGSFSGSGSGSFSGSGSGPEPEPEPESGPEPEPEPEPEPEPEPEPEPEPEPEPEPESGPEPEPEPEPEPEPEPEPEPEPEPEe8010fd4db419c8d61e2baeb4ae8565429582d8fe56c663d8177a341beda8336734d5b1bd212de832aea99e94c98d56217ea9519d900a29c0547538f596a9b26a7bc290bd85ed767a9be19bbf4f23be63658324311413da1b8869932c52d91476b84c7ed5eadf82d4602d57540436b1c79a5187125d11de1be0b51d5b224f75f6a37f0501728ccd5118b3012b7e8fa17ac6f80067887f035e354dd4ab555ba16e09ced2179d58211fbd3371c766307fbbbfa076e1d6110e096674af5ebcfba3545247cbae770e4928ae6817d602343fa6666d74c7787a864070f8dc47e3f9365a0a5f6d23b774508f68c16158c4d03556f9b85f49c64603ea34eb4fb00d9119768f87b8ed67fca052fbd3c20cf6e061f22b3d1d69427cf2bba8dcc554665cdc2c6db9ed36524ca38bf0cf1fa15b3f5b5dfc8b4087b04d06e48e4a6a7e72923d88c53f5d1194e940d5eef2d2cd877f4fc07deb984a56205e2bb9a6273603db3f0a2c4aab538dae9dfad70627e83cc94cba71373e8a33a82456de017433b1be42a4cab6c6327cc33f5df73675ba95887630304ed614f83754edda6379571a45c98548fa28c062445345e2b7c4701dd8449ed3f9ecf8de25ccc311e410c58d0ab37a6443e2a0be2441399d5b44cbf839b0dbf923bac72e0a2e4377bd20e72c99f45ecadcaa82cc148cb39d944a4f286cce077cb1c75b2d4ec1340b40a63f2db42bd2132a07a81b234d2bac1ee651764088be589644de95cb9e3916b59aa2033500b8fbac21bec6db72c9165608a76195f5f68d422952f9c5dc3b54175d3d4196d6e23ae1daa5e6ada0fab3026f16106b986ba97cb0e4111d512ffd33a8ee080b35434f856b4d2c64cdd5ac9a70b927ad2db06e26d21dcb1e9ce1b2bea8ab35fa446cf261fe51ff9f7010a0b7f0f4dc21fd91e2f33aa3f822e8aab8fbda9b0f2ef63f761bf84ce7c8292cb0e9285d8813d605f53fbcb4c261b4903892bdde20a5f2cc33977d65a59a4bae2eb35e177989d1e7ce19d332b64107701160a9bed729ff6e2766739901011d0814124ba1f837ab559cc2dcc25e6c3e97fb164336b57d81b33d112ffbc874e8c936c1d6d4bd27581d5c493b9aa392533374a610b38d182426676c850a72745036800f626be297f9f5c7d9722fd6655f088a20fce32c73ce7181cc669e7561ef77e5f257fcc8db8c6654fd6c60871f3cf093edff81ae12ecd877b4cfb12e8d1ec2d0eccaa9d50dec901e8c8e6fc2e5bfcdc1972a362a6c2a9f2dfb7b3741d89c25256b2456e1bdc834f25f172db10bc5cf57d094b081b9ec93be9b2060d11b103e339b1e74a86e38edf35e00fad1092829504094bdd1387e1d1dbbbfdba47150c36046bb637e61a2f174be54b9a4d1da842d7a89550f126c6680281e5f5f8b06fd1a068565ebdfbb1f72xhXV0k\a$L\a[a20170801-10.el761-urw-z003.confde.urwpp.Z003.metainfo.xml61-urw-z003.confZ003-MediumItalic.afmZ003-MediumItalic.otfZ003-MediumItalic.t1/etc/fonts/conf.d//usr/share/appdata//usr/share/fontconfig/conf.avail//usr/share/fonts/urw-base35/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnuXML 1.0 document, ASCII textASCII font metricsOpenType font dataPostScript Type 1 font text (Z003-MediumItalic 1.00)PPPPPPPPPPP P P P P PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;PP?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZP[P\P]P^P_P`PaPbPcPdPePfPgPhPiPjPkPlPmPnPoPpPqPrPsPtPuPvPwPxPyPzP{P|P}P~PPPPPPPPPPPPPPPPPP P P P P PPPPPPPPPPPPPPPPPPP P!P"P#P$P%P&P'P(P)P*P+P,P-P.P/P0P1P2P3P4P5P6P7P8P9P:P;PP?P@PAPBPCPDPEPFPGPHPIPJPKPLPMPNPOPPPQPRPSPTPUPVPWPXPYPZP[P\P]P^P_P`PaPbPcPdPePfPgPhPiPjPkPlPmPnPoPpPqPrPsPtPuPvPwPxPyPzP{P|P}P~PPPPPPP ( if [[ -x /var/lib/rpm-state/urw-base35-fonts/cache-update-needed ]]; then # mkfontscale /usr/share/fonts/urw-base35 # mkfontdir /usr/share/fonts/urw-base35 # export DISPLAY=:0 # xset fp rehash &> /dev/null || : # true || : rm -rf /var/lib/rpm-state/urw-base35-fonts fi )/bin/sh? F]_$ƨZDr@\we,Z3ynOW>+HZ%tgM , Liw@y:$ܥG5#̈ 9or7$̶t>>%]ޠ-2p^*5=<r^s32ԯaQϱ%IX>#te4^X"p__L/"WlhWz釩 wAF"JJ~^DzUqs Luj;Yy2J өN;yq,-"k˲w8c36`۹S7;(A NO3_ PNnwUY9c>5zkBbm9D W`y"|n1l6^S{4(XE3lЪJo%;D^85 QS.;ns2k؅D?zUj(|ydխxTKT5lD8єؖΜ;wqyw'#8-+xUPcKsCvJkZfdx{o=GmKq rq=qvkX6BH C9r*> xll(BO38eq6@)ӋM򱠑Hi2 zU'*B!c84daadb22794f3ff5b642449ae7d9c414df4e7dbPbgzrISO_6937-2-25.gzrISO_646.IRV.gzrISO_646.BASIC.gzs ISO_5428.so?r ISO_5428.gzs  ISO_5427.sor ISO_5427.gzxyX"X$=ld- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Initial RPM release.0.23-14.el70.23-14.el70.23-14.el710-limitipconn.confmod_limitipconn.somod_limitipconn-0.23INSTALLLICENSEREADME/etc/httpd/conf.modules.d//usr/lib64/httpd/modules//usr/share/doc//usr/share/doc/mod_limitipconn-0.23/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0xea10f0d762fff7adb63cb05a2942ed91ed2660f8, strippeddirectoryRRR?pASj/5,dI|NjhӚHí9rH%;rb296,ᶾ%wWv4 `k6pZQp&d̒;$-O8cb,susaZ̺V74'8{CfhoPzȕ[cZѣتO±xnX۳O{ gV/a3۫"}j_Ba9.ړ)NuG_NEdӚ卆$ kyhbgsXndeT 3Ty ?nrx934(N بAD4#cNt+\Yʕ< *f~[X3@f vz'3S!de ,ْEEMJqb>ny?o bMyE kVK &>膌/cˌDhO#cx)9DF0dAFrg-Y~hXP*c9d41Lrx?4KzQ~>Sj/5,dIi;^(Rj+ﺝ2 M$B/i]\5"j-6C?q*T.k͏TpK9 ߫y*j~g_IoJOcMm򠪚&kM4E{䂗^W/_l [raN&SȘJDſΦ 'eZ$N#ZMDX6IM@ |a,o,ڗ]p0k`\ώ=:-Qe]>G+gM>U?ݔe߱J9EcRK2+P.FوM+Ts wd8"1ʜ"QhL@$VnDžI`-nn>j Z/@,RqMUXi}`R̈f۵{:fu"3$-a >Aԏ.M(cFbEI XIEJ50 z2\+ oŒ+-~x/}vb ?^CL=Z 8e6a0f76f0e5436d7eb09e9647817d686a37d17eb*,brt setting TC max bandwidth rates (Stefan Assmann) [1518088] - [netdrv] i40e: Refactor VF BW rate limiting (Stefan Assmann) [1518088] - [netdrv] i40e: Enable 'channel' mode in mqprio for TC configs (Stefan Assmann) [1518088] - [netdrv] i40e: Add infrastructure for queue channel support (Stefan Assmann) [1518088] - [netdrv] i40e: Add macro for PF reset bit (Stefan Assmann) [1518088] - [netdrv] locking/atomics: coccinelle/treewide: Convert trivial ACCESS_ONCE() patterns to READ_ONCE()/WRITE_ONCE() (Stefan Assmann) [1518088] - [netdrv] i40e: report BPF prog id during XDP_QUERY_PROG (Stefan Assmann) [1518088] - [netdrv] i40e: add support for XDP_TX action (Stefan Assmann) [1518088] - [netdrv] i40e: add XDP support for pass and drop actions (Stefan Assmann) [1518088] - [net] sctp: make use of pre-calculated len (Xin Long) [1590162] - [net] sctp: add a ceiling to optlen in some sockopts (Xin Long) [1590162] - [net] sctp: GFP_ATOMIC is not needed in sctp_setsockopt_events (Xin Long) [1590162] - [net] vti6: Change minimum MTU to IPV4_MIN_MTU, vti6 can carry IPv4 too (Ravi Aysola) [1576491] - [net] ifb: fix packets checksum (Jamie Bainbridge) [1571027] - [net] ipv4: Avoid crashing in ip_error (Lorenzo Bianconi) [1589069] - [net] act_mirred: get rid of tcfm_ifindex from struct tcf_mirred (Ivan Vecera) [1583607] - [net] netfilter: ipv4: fix NULL dereference (Ivan Vecera) [1586215] - [net] ipv4: Namespaceify ip_default_ttl sysctl knob (Ivan Vecera) [1586215] - [net] devlink: convert occ_get op to separate registration (Ivan Vecera) [1584825] - [net] devlink: Remove top_hierarchy arg for DEVLINK disabled path (Ivan Vecera) [1584825] - [net] devlink: Remove top_hierarchy arg to devlink_resource_register (Ivan Vecera) [1584825] - [net] devlink: Fix handling of resource_size_param (Ivan Vecera) [1584825] - [net] devlink: Fix resource coverity errors (Ivan Vecera) [1584825] - [net] devlink: Compare to size_new in case of resource child validation (Ivan Vecera) [1584825] - [net] devlink: Perform cleanup of xiXhU] $87.4.29 - http://www.php.net/releases/7_4_29.php- retrieve tzdata version - use oracle client library version 21.5- Update to 7.4.28 - http://www.php.net/releases/7_4_28.php- Update to 7.4.27 - http://www.php.net/releases/7_4_27.php- ensure we use libgd >= 2.3- update to 7.4.27RC1 - use oracle client library version 21.4- Update to 7.4.26 - http://www.php.net/releases/7_4_26.php- add patch for OpenSSL 3.0, backported from 8.1- update to 7.4.26RC1- dba: enable qdbm backend- Update to 7.4.25 - http://www.php.net/releases/7_4_25.php- update to 7.4.25RC1 - use libicu version 69- Update to 7.4.24 - http://www.php.net/releases/7_4_24.php- update to 7.4.24RC1 - use oracle client library version 21.3- Update to 7.4.23 - http://www.php.net/releases/7_4_23.php- update to 7.4.23RC1- Update to 7.4.22 - http://www.php.net/releases/7_4_22.php- update to 7.4.22RC1- Update to 7.4.21 - http://www.php.net/releases/7_4_21.php- update to 7.4.21RC1 - ignore unsupported "threads" option on password_hash- Update to 7.4.20 - http://www.php.net/releases/7_4_20.php- fix snmp extension build with net-snmp without DES- update to 7.4.20RC1- Update to 7.4.19 - http://www.php.net/releases/7_4_19.php- Update to 7.4.18 - http://www.php.net/releases/7_4_18.php- update to 7.4.18RC1- update to 7.4.17RC1 - use oracle client library version 21.1- Update to 7.4.16 - http://www.php.net/releases/7_4_16.php- update to 7.4.16RC1- Update to 7.4.15 - http://www.php.net/releases/7_4_15.php- add upstream patch for https://bugs.php.net/80682 fix opcache doesn't honour pcre.jit option- update to 7.4.15RC2- Update to 7.4.14 - http://www.php.net/releases/7_4_14.php- update to 7.4.14RC1- fix service dependency name - add dependency on make for devel- Update to 7.4.13 - http://www.php.net/releases/7_4_13.php - use oracle client library version 19.9 (x86_64)- update to 7.4.13RC1- Update to 7.4.12 - http://www.php.net/releases/7_4_12.php- update to 7.4.12RC1- Update to 7.4.11 - http://www.php.net/releases/7_4_11.php- update to 7.4.11RC1- Update to 7.4.10 - http://www.php.net/releases/7_4_10.php- update to 7.4.10RC1 - use oracle client library version 19.8 (x86_64)- Update to 7.4.9 - http://www.php.net/releases/7_4_9.php- update to 7.4.9RC1 - build using ICU 65- Update to 7.4.8 - http://www.php.net/releases/7_4_8.php rebuild from new sources- Update to 7.4.8 - http://www.php.net/releases/7_4_8.php- display build system and provider in phpinfo (from 8.0)- update to 7.4.8RC1 - drop patch to fix PHP_UNAME- Update to 7.4.7 - http://www.php.net/releases/7_4_7.php - rebuild using oniguruma5php - build phpdbg only once- update to 7.4.7RC1- use php-config from embed SAPI to reduce used libs- Update to 7.4.6 - http://www.php.net/releases/7_4_6.php- update to 7.4.6RC1- Update to 7.4.5 - http://www.php.net/releases/7_4_5.php- update to 7.4.5RC1- Update to 7.4.4 - http://www.php.net/releases/7_4_4.php - use oracle client library version 19.6 (18.5 on EL-6)- update to 7.4.4RC1- Update to 7.4.3 - http://www.php.net/releases/7_4_3.php- update to 7.4.3RC1- make sodium mandatory on EL-7, to avoid user confusion https://github.com/remicollet/remirepo/issues/137- Update to 7.4.2 - http://www.php.net/releases/7_4_2.php- update to 7.4.2RC1- Update to 7.4.1 - http://www.php.net/releases/7_4_1.php- update to 7.4.1RC1 - use oracle client library version 19.5- update to 7.4.0 GA- update to 7.4.0RC6- update to 7.4.0RC5 - set opcache.enable_cli in provided default configuration- add /usr/share/php/preload as default ffi.preload configuration- allow wildcards in ffi.preload- fix preload, add more upstream patches for #78713 #78716- fix preload, add upstream patch for #78512- update to 7.4.0RC4- test build with more upstream patches- fix librt issue on F31 using upstream patch- ensure all shared extensions can be loaded- fix broken intl extension on EL-7- update to 7.4.0RC3- fix broken gmp extension https://bugs.php.net/78574- update to 7.4.0RC2 (new tag)- update to 7.4.0RC2 - add tarball signatxYX_`mi$Aii !"#$%&'()*+,-./0123456789:;<=>?@ABCDRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRhttps://bugz.fedoraproject.org/python-certbot-apache?0& 3!}|J^>j/5,d_ j/5,d,m15.,YQڶ}`-JYoƢ:SDL&#m)G)=t!(6; N^Ne=8"~IŐk2r+M2 C"#51  ;!}yb'-;mP62Aa0cZ/ŘuZQ0}m'AnV3ӏq1șqyIׂ"i*u="-.rpqP͛vhp/ G֋ XZvs[t污uɨXqH>v~;<{.( R·ܯ{@ 1㕥: %@sc"GnRI8BC=z9'A>D(͓sx'Ni N"Vbm(5jVia(h>^;^`Gtڵ/MΕltxvcx n؛Y3rNa!=1Zt3!}|J^>j/5,d_ j/5,d同2fEFaH.1 Ʈu)oKjE޴y:KONJ5Y|i)dMh @z㧇g8w]^Ciy($c+H*^bGrR׫wa6䰩H%tUd6MZVfg[I5=/V7ݜ0ݵj?ckʌ= ~:%1'Xafv,ިdz|eٟ Q3] }CqFWR n1|Ӿ $"d]ݎYn @n @ki)4T`, s)&mq':BS.!IׅT~nlM]-@H?+| waECNPI$A|oΨƙ&F*VLnZm8YH I_Su37T.'>8 2.,k 26e943dd5cf78939020f94acda5794e55e736ed6b$ ITb eam release.- initial versionp[d texinfos.ame texinfo.vim[t texinfo.texW texinfo.amfVtexinfo-filter.soUtexinfo-filter.info0.[c texibuild.am[b texi-vers.am eeene)tex.vim0.@tex.pnge@tex.gifeTatex.amf aSt tex-filter.soRstex-filter.infof b'2R\R"2S]S#2W\W"2Y\Y"2[\["2]\]"2`\`"2c\c"2f\f"2i\i"2etet (?H testsuitel testspeed.mod testscanw.cC testsaslauthd.8.gzCe testsaslauthd>?G?e tests.pyo>?F?~e tests.pyc>?E?}itests.pya(R8S8W8Y8[8]8`8c8f8i8voQ testsl testload.modB testlib.pmGstestlayer.zcmlV testlayer.txtPa testlayer.pyoOf testlayer.pycNn testlayer.py.~testlayer.html.hD&e testing.txteMa testing.pyoLt testing.pycKt testing.pyof Igtestgdbm=t testfilesxHXVsZ&$6&'ating@redhat.com> - 1.01-15Jason Vas Dias - 1.01-14.2Jesse Keating Jesse Keating Jose Pedro Oliveira - 1.01-14Chip Turner 1.01-13Chip Turner 1.01-12Chip Turner Chip Turner Chip Turner cturner@redhat.com- Mass rebuild 2013-12-27- Rebuild for perl 5.16- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Perl 5.16 rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- update to 1.03- Perl mass rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- 661697 rebuild for fixing problems with vendorach/lib- Mass rebuild with perl-5.12.0- Mass rebuild with perl-5.12.0- version bump - rfc2104.txt removed by upstream- rebuild against perl 5.10.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Rebuild for perl 5.10 (again)- rebuild for new perl- fix various issues from package review- Fix license tag - add %doc section - Add BuildRequire: perl(ExtUtils::MakeMaker)- rebuild for new perl-5.8.8- rebuild for new perl-5.8.8- rebuilt for new gcc- rebuilt for new gcj- Bring up to date with current Fedora.Extras perl spec template. (#155912)- rebuild- bump- version bump and rebuild- automated release bump and build- description update- Specfile autogenerated 1.031.03-5.el7perl-Digest-HMAC-1.03ChangesREADMEDigest::HMAC.3pm.gzDigest::HMAC_MD5.3pm.gzDigest::HMAC_SHA1.3pm.gzDigestHMAC.pmHMAC_MD5.pmHMAC_SHA1.pm/usr/share/doc//usr/share/doc/perl-Digest-HMAC-1.03//usr/share/man/man3//usr/share/perl5/vendor_perl//usr/share/perl5/vendor_perl/Digest/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnudirectoryASCII texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)Perl5 module source text PRRRPRRRRRPRRRRR?;LS*$ƨjd?e,S hm<gnryX8*@ru x7$WӳM= ӉS*$ƨ@{m$dgLOŐgYGHCd|)/RqTY9pхF,A)Ka}ȕ>}&*ލQXboO)~hEz]8b|%А 0>6h|!eT&' |_oeypiBx6D=!Z׊'!^ ,#~LIӫ4n)Եz*q9ʫ[fkC"rgY X#'{"d{,lhA8heȅaEWqm()Koƞb-.|JЉxVӯb'_}sy!?9'!Wb@ B^3G4n)VdD=]ɔ"::ۅk'>gedEA mD/Y)J@ WY3;TLE7BzեdĵQg_ReEAH`sb\G$y&60c9029f736b7fc96bdff7f1a34a37e69399b9fcb9(bision problem in the microseconds range (Xunlei Pang) [1298387] - [kernel] sched/deadline: Delete extraneous extern for to_ratio() (Xunlei Pang) [1298387] - [kernel] sched/deadline: Fix race in dl_task_timer() (Xunlei Pang) [1298387] - [kernel] sched/deadline: Restrict user params max value to 2^63 ns (Xunlei Pang) [1298387] - [kernel] sched/deadx8XB`8^`$?` xsgbVQE@4/# ythcWRFA50$ z u i d X S G B 6 1 %    { v j e Y T H C 7 2 & !    | w k f Z U I D 8 3 ' "    } x l g [ V J E 9 4 ( #     ~ y m h \ W K F : 5 ) $     zni]XLG;6*%{oj^YMH<7+& |pk_ZNI=8,' }ql`[OJ>9-( ~rma\PK?s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s<s< ##^ɚ P(ɚ<$dr ̃ Sd v">c4+3ɚ\vPɚA%>$yB=0$<H:d29H7dJ06)/50864h"211/$.B-0,)*~0()'Ѐ|>&%%#"̐t!&(|> }C4Kķ PQ?8{}аҁPf  } 6dn8~xx'XVpcnI$~nImIoI - 0.4.1-4.cvs20051009Dan Williams - 0.4.1-3.cvs20050922Jeremy Katz - 0.4.1-2.cvs20050912Dan Williams - 0.4.1-2.cvs20050819Dan Williams - 0.4.1Dan Williams - 0.4-36.cvs20050811Dan Williams - 0.4-35.cvs20050811Ray Strode - 0.4-34.cvs20050729Dan Williams - 0.4-34.cvs20050629David Zeuthen - 0.4-33.cvs20050629Dan Williams - 0.4-32.cvs20050617Dan Williams - 0.4-31.cvs20050616Dan Williams - 0.4-30.cvs20050615Dan Williams - 0.4-15.cvs30050404Dan Williams - 0.4-14.cvs30050404Dan Williams - 0.4-13.cvs30050404Dan Williams - 0.4-12.cvs20050404Dan Williams - 0.4-11.cvs20050404Dan Williams - 0.4-10.cvs20050404Dan Williams - 0.4-9.cvs20050404Jeremy Katz - 0.4-8.cvs20050404Jeremy Katz - 0.4-7.cvs20050404Dan Williams 0.4-6.cvs20050404Dan Williams 0.4-5.cvs20050402Christopher Aillon 0.4-4.cvs20050315Ray Strode 0.4-3.cvs20050315Ray Strode 0.4-2.cvs20050315Ray Strode 0.4-1.cvs20050315Ray Strode 0.4-1.cvs20050307Dan Williams 0.3.4-1.cvs20050304Dan Williams 0.3.3-2.cvs20050222Dan Williams 0.3.3-2.cvs20050214.x.1Dan Williams 0.3.3-2.cvs20050214Dan Williams 0.3.3-1.cvs20050202Dan Williams 0.3.3-1.cvs20050125Dan Williams 0.3.3-1.cvs20050124Than Ngo 0.3.3-1.cvs20050112.4 - 0.3.3-1.cvs20050118 - 0.3.3-1.cvs20050112 - 0.3.2-4.3.cvs20041208 - 0.3.2-3.cvs20041117 - 0.3.2-2.cvs20041115 - 0.3.2-2.cvs20041029 - 0.3.1-2 - 0.3.1-1Dan Williams 0.3-1Dan Williams 0.2-4Dan Williams 0.2-3Dan Williams 0.2-2Dan Williams 0.2-1Florian La Roche Dan Williams 0.1-3- Backport OVS related fixes (rh #1871935) - ovs: support changing the MTU of ovs interfaces (rh #1820052) - ovs: fix race condition in setting MAC address (rh #1852106)- Update to 1.18.8 relase - ifcfg-rh: handle "802-1x.{,phase2-}ca-path" (rh #1841397, CVE-2020-10754) - ifcfg-rh: handle 802-1x.pin properties.- ip-tunnel: set cloned-mac-address only for layer2 tunnel devices (rh #1832170)- Update translations (rh #1796852)- vpn: gracefully handle invalid routes from VPN plugins - workaround g_strtoll() failing with EAGAIN (rh #1797915)- Update to 1.18.6 release - cli: unset "ipv[46].never-default" when setting "ipv[46].gateway" (rh #1785039) - core: keep MTU of MACsec and MAC-VLAN interfaces in sync with parent (rh #1723690) - core: forbid autoactivation of parent when it is blocked by user request (rh #1765566)- ovs: allow changing mac address of bridges and interfaces (rh #1740557)- dhcp: include conditionals from existing dhclient configuration (rh #1758550) - core: fix sending ARP announcements (rh #1767681)- Update to 1.18.4 release - cli: fix bash completion for slave-types (rh #1654062) - core: improve handling of policy routing rules when restarting daemon (rh #1696881) - ifcfg-rh: preserve existance of ethernet setting in profile (rh #1703960) - tui: only add bond options to profile that are supported by tui (rh #1715720) - cli: fix resetting default value for properties (rh #1715887) - core: fix detecting parent device by connection's UUID (rh #1716438) - core: fix setting IPv6 route options and destination (rh #1727193) - core: support more "arp_validate" bond options xXXh7-$Jneering - 1.0.90-2Adam Tkac 1.0.90-1Adam Tkac 1.0.1-3jkeating - 1.0.1-2Adam Tkac 1.0.1-1Adam Tkac 1.0.0-3Adam Tkac 1.0.0-2Adam Tkac 1.0.0-1Adam Tkac 0.0.93-13Rex Dieter 0.0.93-12Rex Dieter 0.0.93-11Adam Tkac 0.0.93-10Adam Tkac 0.0.93-9Adam Tkac 0.0.93-8Adam Tkac 0.0.93-7Adam Tkac 0.0.93-6Adam Tkac 0.0.93-5Adam Tkac 0.0.93-4Adam Tkac 0.0.93-3Adam Tkac 0.0.93-2Adam Tkac 0.0.93-1- Fix CVE-2018-14498 (#1687475)- Fix CVE-2018-11212 (#1586062) - Fix CVE-2016-3616 (#1318509), CVE-2018-11213 (#1589091) and CVE-2018-11214 (#1589110) - Fix CVE-2018-11813 (#1591203)- Add pkgconfig scripts (#1581687)- Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- Resolves: #1031739 app patches CVE-2013-6629 and CVE-2013-6630- rebuild for ARM64 support- update to 1.2.90- update to 1.2.80 snapshot (#854695) - run `make test` during build- build with jpeg6 API/ABI (jpeg8-ABI feature was dropped)- change license to IJG (#877517)- build with jpeg8 API/ABI (#854695)- minor provides tuning (#863231)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- update to 1.2.1- update to 1.2.0- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Make turobojpeg-devel depend on turbojpeg- Ship the turbojpeg library (#744258)- update to 1.1.1 - ljt11-rh688712.patch merged- handle broken JPEGs better (#688712)- update to 1.1.0- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 1.0.90 - libjpeg-turbo10-rh639672.patch merged- add support for arithmetic coded files into decoder (#639672)- Rebuilt for gcc bug 634757- update to 1.0.1 - libjpeg-turbo10-rh617469.patch merged - add -static subpkg (#632859)- fix huffman decoder to handle broken JPEGs well (#617469)- add libjpeg-devel%{_isa} provides to -devel subpkg to satisfy imlib-devel deps- update to 1.0.0 - patches merged - libjpeg-turbo-programs.patch - libjpeg-turbo-nosimd.patch - add libjpeg provides to the main package to workaround problems with broken java-1.6.0-openjdk package- remove libjpeg provides from -utils subpkg- move Obsoletes: libjpeg to main pkg- -utils: Requires: %name ...- add Provides = libjpeg to -utils subpackage- merge review related fixes (#600243)- merge review related fixes (#600243)- obsolete -static libjpeg subpackage (#600243)- improve package description a little (#600243) - include example.c as %doc in the -devel subpackage- don't use "fc12" disttag in obsoletes/provides (#600243)- fix compilation on platforms without MMX/SSE (#600243)- package review related fixes (#600243)- package review related fixes (#600243)- initial packagelibjpeg-devel 6b-47.el76b-47.el71.2.90-8.el71.2.90-8.el71.2.906b-47jconfig.hjerror.hjmorecfg.hjpeglib.hlibjpeg.solibjpeg.pclibjpeg-turbo-devel-1.2.90coderules.txtexample.cjconfig.txtlibjpeg.txtstructure.txt/usr/include//usr/lib64//usr/lib64/pkgconfig//usr/share/doc//usr/share/doc/libjpeg-turbo-devel-1.2.90/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuASCII textC source, ASCII textpkgconfig filedirectoryRPR?P]_ i$ƨ-xhXWxX8"q $aq r p ca90f4e288e898724160ee387bee47d06bf7507737a647ff0a3f69156fcb5bf2902be195d05e278613f2da676b8f95e14c014403d24a18e9172dffe0c5822d81b9fdc18ae1533d5536dc113abbf4ac508fddf6b18994609d0b277a75e5a8daf239cf74dcc51a985959e4bdc974b3c330c9ab2f473a2791a19f727708f8c33d9ee4ef5bfc98ac108b1746acf5fcf70c792b0605fbec9ea6eaff2b4334149c1cfaa1a800b28ae6b775e2180f1af1261b75b6d91605549c94ef4d1c6ed04a22b56393c955d7ddd249b43b0c2e1da5fff613878167483b726cde781aac11b94c9aa58c58f806be534d2c03934b63b86c765023f33ab5269741de76e66f3c212e91d0fa73b9e4bd2e699989ee1403f5313e1206ef01a20ef2f648910706b3d48beeb4371176b8ae20ab6f88eb9bc9728e81b03d945b6cb445c524b1b76d7f7a0e9532c944ab36b275414a21c8aececb3aef3d9f7aa83a4eb20a4ca96e13ea6704fa3882249e9bb1c32101683fd9227f7386244b0d59a75205a83040f19406de06d6ca4d4dd421b05b392a049c3cc2cb249305a8f01757cbfa38cb06d1f9dc6e08764035aff15ad6596d1156966488c79b1a706edb91c14ccb304663223bd5dee3dd404dd414d39f8b497df68bc3daa90ca27d98efb2b5b4d49c90ca904b718c28db97e603aa03c97a2b95d87a061d776616886426537d98acebaeec69712c9994dde499b6912a84f71b388f16d6711a4da2192fc5edbff0ad2cc29e62c5e4cd39da4c132836e24386390623f9c17e15bf919d4aec37f76d70021957b0a085d0b9a2ee79f1486e7449d1a15f09e2df8ac1ca29fdd60a1854f65a284f0822e181fd96d4d05a10106f828963cc970dc6034265a82e88368afa9a391d07e98afaf1887eb91a4bd5b0886e04c7caa3b32b9e0c1d054379451ff015a58acd14d1e73505b68de0ccc7e65f15cb9e01e1121d541bdc61c9b337467b3fc8a22123efa842f7951486e19ff0c748805e0caa192f8a864b68ef1fcccbf0c411a5ae573b293cf0f015ae423ce87b699b2b7438e6ff7907d969b789bd7039f3a0a6a92638fc21d7181c2348bed4a8c083c663235382cb2533de3d8a414d966c9ca4b9f499b3c6efc9e192b5aca9bedbf2fcedd97299b73b1bfcf965f82a16be661b64ba42f05467e5476db34bcb8d91f250257aeb3480e51119cee4639675da9cc74d9eb47286437fffb0e02fc7e703df0739b8a0ff74080b91e6a05e9c1d42950b15fa825e74cb24d67cb31fcd6047da6eb4bda8863bc9df9e52daf9e3063ee826e3cb6b01b9b98991fc2b8a6e59dbd276d6cfca35818e6fcf1ca1a814f3cd3a13362212cbdad84cc33a7574d8048400c5a7985850bc21067ed823a4746eda99d6747ec733d4e0f62d31511640f2d65806f3a1f5410d1657790adeda1b7d48d7e4a7ffdbb8dc927afe7b0eeba5dc287ca296bec6a9883f299a1afe515908a3555bfa1093728523e96b55c367ccde9648b4a73f0e38aecf55e2a0e10c12873512d1d21b399be8ae236d2d12832446e7a6c230547c082b23e0fb0e4f9a27cb1da25ae8b5eeae73f0ea941ba7c0a7c07eb6c0d94f4cad027474a2f8506141047c44149f861520d5ee657a45ead530bbb70edc39fef86dfcffd62deb373825cc1d074797fa0280f2b10dcad5f231e583689a849fdf887c8d4cbcacac3d183c694f8666c5040740a91cd4a4d6717106bda10f645ea1594769775c74ac5b4f5418acc579d21127836119a4e30f8224556822e8c0f04b9ade15f7f732e537986c9c830cf5d8a4a96581fa2e7b8c5973bb537dc4430b1f3c31e5963f93aae8b80ef254d60de16ce8b07ce9309f47763d7d8f224fb60c05940080d07b62ce07b1d7c50bf73ec00d87c2572993f17a7a054e58b03c81e8c406b318e74fecfe76bc88c2becd1d1a1b008b9ff14408ae1d8fa22179f77b36bd721a0c7cd27490fdf320b77a27666c316f776f9db735c5ccfc5842152a9cc241bba4033d5b57111c526e8d0a7a8bb94a9fb83c289d6fa82690543f77dfcde61d13ee4fc2e91eb88b90fe8c19d33781b4be39c78ea3637f0918a443259e53f7f41aaaf1b540e2784756ef6f16f61b63df0d9956483aded3c49b6e0f4826d80e9862b0ad4042d55ffbd9eec7cc468b37abf3f1a426c9c6d993f2ab5a55e8387f92ae98cd23b5d658b983b668148ca149e4016f2342983d64d00d33fbc1967e3c9fb3079e4f48d01cca3a6adc03e23701b2dd2a0f2229e9d48604dc2508d647124640889c4ba4317c577865a6a8383647b1f42323a302ae5e15cb444ee08e19218a400a7fd5f9536b87d7afa08fec94460584db0cec30e2013657cc578b071bc014eb92e3d0f084d30be135ae57ecef1fe65c4c1fe327a56b3b8a06b2c7e2298957e44249cb40a521187f4b8f5fd6d745bf9a25fd674f5a21e16ef0e407d0ab3d62a805357bfed30d6b0fbe22c16af393b887f304cd761436fc2bf749e031c5ed4e062fb5e35affd1ac3a5f4df6c02bd0fe851f4bb747c8459441f0ac2532d661a78a3a264704e7e183249a535782dbe82cbb6c60c0e9684415521db5d712e6a767426eef51414daaa89cb79ec8983e54fced4f533fe31dcb2030b71e2f817ddfe4d21dcf16865cfe29f70ecbffb8de9108d84f205474dab08fab494f6f98d2bcdf6b00c14e1fadc5c5dca15f37e5088017b46a2b67b3d921975ef31aeda3cde23122f1dd200c7e83696a02d24bef0c2c20e5ad79bee6495a20139f85adbd4e59bf60e9457b97dabf4cfadb260b7c9e5f79d7226051885d4144a38b9870f7985387f872xXYW`$php-fpmphp71-php-fpm(x86-64)    @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ php71-php-common(x86-64)systemdsystemdsystemdsystemd-sysv/usr/sbin/useradd/bin/sh/bin/sh/bin/sh/bin/sh/bin/shrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.2)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libc.so.6(GLIBC_2.8)(64bit)libcom_err.so.2()(64bit)libcrypt.so.1()(64bit)libcrypto.so.10()(64bit)libcrypto.so.10(OPENSSL_1.0.1_EC)(64bit)libcrypto.so.10(OPENSSL_1.0.2)(64bit)libcrypto.so.10(libcrypto.so.10)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libgssapi_krb5.so.2()(64bit)libk5crypto.so.3()(64bit)libkrb5.so.3()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libnsl.so.1()(64bit)libresolv.so.2()(64bit)libresolv.so.2(GLIBC_2.2.5)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.2.5)(64bit)libssl.so.10()(64bit)libssl.so.10(libssl.so.10)(64bit)libsystemd.so.0()(64bit)libsystemd.so.0(LIBSYSTEMD_209)(64bit)libxml2.so.2()(64bit)libxml2.so.2(LIBXML2_2.4.30)(64bit)libxml2.so.2(LIBXML2_2.5.2)(64bit)libxml2.so.2(LIBXML2_2.6.0)(64bit)libxml2.so.2(LIBXML2_2.6.11)(64bit)libz.so.1()(64bit)rtld(GNU_HASH)rpmlib(PayloadIsXz)7.1.33-29.el7.remi4.6.0-14.0-13.0.4-15.2-14.11.3if [ -f /etc/rc.d/init.d/php71-php-fpm ]; then # Save the current service runlevel info # User must manually run systemd-sysv-convert --apply php-fpm # to migrate them to systemd targets /usr/bin/systemd-sysv-convert --save php71-php-fpm >/dev/null 2>&1 || : # Run these because the SysV package being removed won't do them /sbin/chkconfig --del php71-php-fpm >/dev/null 2>&1 || : /bin/systemctl try-restart php71-php-fpm.service >/dev/null 2>&1 || : fiphp71-php-fpmf_f@dd@dq@cwcR@c2b=aKapa7T@a&0`ٹ``N@`@_@_s!_)M^^^p^K^)]@]@]fl]A]G@\"\Ɋ@\N\@\A\5@\ @\[@[_[[^[^[[i@[@[@[t[P}@[?Y[+@[@[@Zz@Z(ZmZZ`@ZZ$U2G@U/@UU@U@U@U@U @T9T@TTC@TTp@T5Tw@TuThTd@TVT?@T.Tk@SSSr @S,)S?SR@R@R@RRRRR_@R:@RQ@QY@QY@QQQ@Q@QQyQfQ@j@P@PѬ@PP@P@P*P@P@P)P)PPPPPP5@P{Px@Pl(Pj@PiPiPe@P`K@PYPYPYPXb@PWPS@P2&P.2@P H@O@O@O O@O\@Os@O@O@OvOtNOpZ@OpZ@OP@O?O-OO@O @NNN@N@N @NoENS@NLN7@MMMMTMtMk@MfH@MRM'@M@M@MgL8LΫLʷ@LLH2K@K@KCK@K @KK@J@JlE@J_@J_@J\s@JY@J> I'@I@II@I@I}I|T@Iy@ICI>]I:i@I9I*@I9@H˫@H(H{?Hv@GGZ@Gt@GVGVGV@FFڥF@FS@FS@F]FFw@FiDFAF@f@F; @F @F@Eّ@EK@EE3@Eu_@El$El$Ej@E[@E[@EG:E#@D,@D@DbDbD(@DtJDlaD_2DX@D;@C@CCQ@CˊCǖ@C @CCf@CqC @C@C7@C@Cs6@CoACgXC(BiB{\@BwgBlB] B] B] B[@BZfBQ,@BM7BJBBBB @A@AAA_A_A_AJAJAJA@EA @Ag@Remi Collet - 7.1.33-29Remi Collet - 7.1.33-28Remi Collet - 7.1.33-27Remi Collet xHXW2xW$GWXV-5Matthias Clasen 2.3.9-4Behdad Esfahbod 2.3.9-3Behdad Esfahbod 2.3.9-2Behdad Esfahbod 2.3.9-1Behdad Esfahbod 2.3.8-2.1Fedora Release Engineering - 2.3.8-2Behdad Esfahbod 2.3.8-1Behdad Esfahbod 2.3.7-3Behdad Esfahbod 2.3.7-2Behdad Esfahbod 2.3.7-1Behdad Esfahbod 2.3.6-1Tom "spot" Callaway - 2.3.5-5Fedora Release Engineering - 2.3.5-4Adam Jackson - 2.3.5-3Behdad Esfahbod 2.3.5-2Behdad Esfahbod 2.3.5-1Adam Jackson 2.3.4-4Behdad Esfahbod 2.3.4-3Behdad Esfahbod 2.3.4-2Behdad Esfahbod 2.3.4-1Behdad Esfahbod 2.3.3-2Behdad Esfahbod 2.3.3-1Behdad Esfahbod 2.3.2-1Behdad Esfahbod 2.3.1-1Behdad Esfahbod 2.3.0-2Behdad Esfahbod 2.3.0-1Behdad Esfahbod 2.2.1-16Behdad Esfahbod 2.2.1-10Behdad Esfahbod 2.2.1-9Behdad Esfahbod 2.2.1-8Matthias Clasen - 2.2.1-7Jesse Keating - 2.2.1-6Jesse Keating - 2.2.1-5Matthias Clasen - 2.2.1-4.fc6Matthias Clasen - 2.2.1-3Jesse Keating - 2.2.1-2.1Behdad Esfahbod 2.2.1-2Behdad Esfahbod 2.2.1-1Karsten Hopp 2.1.10-6Jesse Keating - 2.1.10-5.2.1Jesse Keating - 2.1.10-5.2Jesse Keating Bill Nottingham 2.1.10-5Matthias Clasen 2.1.10-4Matthias Clasen 2.1.10-3Jason Vas Dias 2.1.10-2Matthias Clasen 2.1.10-1Kristian Høgsberg 2.1.9-4Karsten Hopp 2.1.9-3David Zeuthen - 2.1.9-2Owen Taylor - 2.1.9-1Elliot Lee Owen Taylor 2.1.7-4Mike A. Harris 2.1.7-3Elliot Lee 2.1.7-2.1Elliot Lee 2.1.7-2Owen Taylor 2.1.7-1Florian La Roche Elliot Lee 2.1.4-4.1Owen Taylor 2.1.4-4.0Owen Taylor 2.1.4-3Owen Taylor 2.1.4-1Elliot Lee Jeremy Katz 2.1.3-9Owen Taylor Elliot Lee 2.1.3-7Owen Taylor Tim Powers Owen Taylor 2.1.3-4Owen Taylor 2.1.3-3Mike A. Harris 2.1.3-2Florian La Roche Elliot Lee 2.1.2-11Mike A. Harris 2.1.2-10Tim Powers 2.1.2-8Owen Taylor Owen Taylor Owen Taylor Owen Taylor Owen Taylor Owen Taylor Owen Taylor Mike A. Harris 2.1.1-2Owen Taylor 2.1.1-1Owen Taylor Tim Powers Mike A. Harris 2.1.0-2Nalin Dahyabhai 2.0.9-2Mike A. Harris 2.0.9-1Mike A. Harris 2.0.8-4Mike A. Harris 2.0.8-3Mike A. Harris 2.0.8-2Tim Powers 2.0.6-3Mike A. Harris 2.0.6-2Mike A. HarrxXU`/`<$6<<<t output-delimiter - drop coreutils-libs subpackage, no longer needed- incorporate some i18n patch fixes from OpenSUSE: - fix cut output-delimiter option - prevent infinite loop in sort when ignoring chars - prevent using unitialized variable in cut- su: fix shell suspend in tcsh (#597928)- variable "u" should be static in uname processor type patch- deprecate non-upstream cp -Z/--context (install should be used instead of it), make it working if destination exists (#715557)- use acl_extended_file_nofollow() if available (#692823)- support ecryptfs mount of Private (postlogin into su.pamd) (#722323)- new upstream release 8.12- fix issue with df --direct(extra new line)- new upstream release 8.11, defuzz patches- add note about mkdir mode behaviour into info documentation (#610559)- fix possible uninitalized variables usage caused by i18n patch(#683799)- make coreutils build even without patches (with nopam, norunuser and noselinux variables)- colorize documents by DIR_COLORS files(brown like mc)- add several new TERMs to DIR_COLORS files(#678147)- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- new upstream release coreutils-8.10- drop no longer needed mkstemp patch for sparc- new upstream release coreutils-8.9- The suffix length was dependent on the number of bytes or lines per file (#666293)- fix parallel sorting issue (#655096) - new upstream release coreutils-8.8 (#665164)- don't prompt for password with runuser(#654367)- new upstream release coreutils-8.7 - pam support in su consolidation with SUSE(#622700)- prevent sort from assertion failure in case LC_CTYPE does not match LC_TIME (#647938)- improve i18n support in sort (debug-keys test is now back)- new upstream release 8.6 - remove applied patches, temporarily disable sort debug-keys test for multibyte locales (failing because of i18n patch)- various fixes for case conversion in tr(#611274)- Rebuilt for gcc bug 634757- change assertion failure for invalid multibyte input in sort to less confusing error message(#591352)- add RELRO protection to su as well (#630017)- compile su with pie again (#630017)- fix double free abort in tac (#628213)- Add .ear, .war, .sar , for Java jar-like archives to dircolors (#616497)- rebuilt with the updated configuration patch - drop the old -O1 exception for s390(x) - updated the getgrouplist patch (Kamil Dudka)- doublequote LS_COLORS in colorls.*sh scripts to speedup shell start(#586029) - add patch for mkstemp on sparc64(Dennis Gilmore) - update /etc/DIR_COLORS* files- new upstream release 8.5- move readlink from /usr/bin to bin, keep symlink in /usr/bin(#580682)- a new option df --direct- run tput colors in colorls profile.d scripts only in the interactive mode(#450424)- fix exit status of terminated child processes in su with pam(#559098)- do not depend on selinux patch application in _require_selinux tests(#556350)- do not fail tests if there are no loopdevices left (#558898)- who doesn't determine user's message status correctly (#454261)- new upstream release 8.4- new upstream release 8.3- require gmp-devel/gmp for large numbers support(#552846)- fix misc/selinux root-only test(#550494)- bring back uname -p/-i functionality except of the athlon hack(#548834) - comment patches- use grep instead of deprecated egrep in colorls.sh script (#548174) - remove unnecessary versioned requires/conflicts - remove non-upstream hack for uname -p- fix DIR_COLORS.256color file- new upstream release 8.2 - removed applied patches, temporarily do not run dup_cloexec() dependent gnulib tests failing in koji- new upstream release 8.1 - fix build under koji (no test failures with underlying RHEL-5 XEN kernel due to unsearchable path and lack of futimens functionality)- update /etc/DIR_COLORS* files- New upstream release 8.0 (beta), defuzz patches, remove applied patches- chcon no longer aborts on a selinux disabled system (#527142)- ls -LR exits with status 2, not 0, when it encounters a x8X/X X $Y skasal@redhat.com> - 20081208-2Stepan Kasal - 20081208-1Fedora Release Engineering - 20081020-3Fedora Release Engineering - 20081020-2Stepan Kasal - 20081020-1Tom "spot" Callaway - 1.15-4Robin Norwood - 1.15-3Robin Norwood - 1.15-2Robin Norwood - 1.15-1- Mass rebuild 2013-12-27- Update to 20120719.001: - Require Test::More ≥ 0.95 for subtest support - No code or feature changes - Bump Test::Manifest version requirement to 1.21 - Bump Test::More version requirement to 0.95 - Drop redundant buildreq perl(Test::Prereq)- Update to 20120719: - Support using data from RangeMessage.xml, so you can use the latest data from ISBN without updating this module - Fix shellbang and permissions of make_data.pl script to placate rpmlint - Filter dependency on perl(LWP::Simple), required only by make_data.pl script, not in normal operation - Don't need to remove empty directories from the buildroot - BR: perl(Carp), perl(File::Spec::Functions) and perl(Test::Manifest) ≥ 1.14 - BR: at least version 1.00 of perl(Test::Pod)- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Perl 5.16 rebuild- Clean up for modern rpmbuild: - Drop BuildRoot specification - Drop %clean section - Don't bother cleaning buildroot in %install section - Make %files list more explicit - Use DESTDIR rather than PERL_INSTALL_ROOT - Use %{_fixperms} macro rather than our own chmod incantation - Replace provides filter with version that works with rpm ≥ 4.9 - Include tests as %doc since they're referred to by examples/README- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Perl mass rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Rebuild to fix problems with vendorarch/lib (#661697)- Mass rebuild with perl-5.12.0- rebuild against perl 5.10.1- new upstream version- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- new upstream version- rebuild for new perl- Should not provide perl(Business::ISBN)- Fix BuildRequires- Initial build 20120719.00120120719.001-2.el7perl-Business-ISBN-Data-20120719.001ChangesLICENSEREADMEexamplesREADMEtcheck_data_structure.tload.tpod.tpod_coverage.ttest_manifestBusiness::ISBN::Data.3pm.gzBusinessISBNData.pmRangeMessage.xmlmake_data.pl/usr/share/doc//usr/share/doc/perl-Business-ISBN-Data-20120719.001//usr/share/doc/perl-Business-ISBN-Data-20120719.001/examples//usr/share/doc/perl-Business-ISBN-Data-20120719.001/t//usr/share/man/man3//usr/share/perl5/vendor_perl//usr/share/perl5/vendor_perl/Business//usr/share/perl5/vendor_perl/Business/ISBN/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnudirectoryASCII text, with escape sequencesASCII text, with no line terminatorsASCII textPerl script, ASCII text executableawk script, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)Perl5 module source textXML document textPRRRRRRRRR?[S*K$ƨ* w1+q :lNƣ[qaa ֗9E֤!F̥36nZsT)eRxXfWu$euv ithout confusion- fix phpize installation for lib64 platforms - add fix for segfault in variable parsing introduced in 5.0.2- update to 5.0.2 (#127980) - build against mysqlclient10-devel - use new RTLD_DEEPBIND to load extension modules - drop explicit requirement for elfutils-devel - use AddHandler in default conf.d/php.conf (#135664) - "fix" round() fudging for recent gcc on x86 - disable sqlite pending audit of warnings and subpackage split- don't build dom extension into 2.0 SAPI- ExclusiveArch: x86 ppc x86_64 for the moment- fix default extension_dir and conf.d/php.conf- update to 5.0.1 - only build shared modules once - put dom extension in php-dom subpackage again - move extension modules into %{_libdir}/php/modules - don't use --with-regex=system, it's ignored for the apache* SAPIs- Merge in some spec file changes from Jeff Stern (jastern@uci.edu)- bump to 5.0.0 - add patch to prevent clobbering struct re_registers from regex.h - remove domxml references, replaced with dom now built-in - fix php.ini to refer to php5 not php4/bin/sh/bin/sh/bin/sh/bin/sh/bin/sh 7.1.33-29.el7.remi7.1.33-29.el7.remi php71-php-fpmphp-fpm.confphp-fpm.dwww.confphp-fpmphp71-php-fpm.service.dphp-fpmphp71-php-fpm-7.1.33php-fpm.conf.defaultwww.conf.defaultfpmstatus.htmlphp71-php-fpm-7.1.33fpm_LICENSEphp-fpm.8.gzphp71-php-fpm.serviceopcachesessionwsdlcachephp-fpmphp-fpm/etc/logrotate.d//etc/opt/remi/php71//etc/opt/remi/php71/php-fpm.d//etc/opt/remi/php71/sysconfig//etc/systemd/system//opt/remi/php71/root/usr/sbin//opt/remi/php71/root/usr/share/doc//opt/remi/php71/root/usr/share/doc/php71-php-fpm-7.1.33//opt/remi/php71/root/usr/share//opt/remi/php71/root/usr/share/fpm//opt/remi/php71/root/usr/share/licenses//opt/remi/php71/root/usr/share/licenses/php71-php-fpm-7.1.33//opt/remi/php71/root/usr/share/man/man8//usr/lib/systemd/system//var/opt/remi/php71/lib/php//var/opt/remi/php71/log//var/opt/remi/php71/run/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuhttps://forum.remirepo.net/?Hd}}ǯ]!LΈJ]NoGVf` NoGVjL-OU8f̿&,<\a53Yd]!LΈJ]NoGVf` NoGVTʠAMz=@vYpl斞١&ÉQ.`4e876851d08c240c645b3b515cddad58898c46f6g v'KTg uty() races with cil commit sequence (Brian Foster) [1028505] - [fs] xfs: fix quota block reservation leak when tp allocates and frees blocks (Brian Foster) [1068915] - [fs] xfs: always log the inode on unwritten extent conversion (Brian Foster) [1053384] - [fs] xfs: direct IO EOF zeroing needs to drain AIO (Brian Foster) [1213370] - [fs] xfs: DIO write completion size updates race (Brian Foster) [1213370] - [fs] nfsv4.2: handle NFS-specific llseek errors ("J. Bruce Fields") [1079385] - [fs] nfsd4: disallow SEEK with special stateids ("J. Bruce Fields") [1079385] - [fs] nfsd4: disallow ALLOCATE with special stateids ("J. Bruce Fields") [1079385] - [fs] nfs: Reduce time spent holding the i_mutex during fallocate() ("J. Bruce Fields") [1079385] - [fs] nfs: Don't zap caches on fallocate() ("J. Bruce Fields") [1079385] - [fs] nfs: Add DEALLOCATE support ("J. Bruce Fields") [1079385] - [fs] nfs: Add ALLOCATE support ("J. Bruce Fields") [1079385] - [fs] nfs: Use nfs_server_capable() for checknig NFS_CAP_SEEK ("J. Bruce Fields") [1079385] - [fs] nfsd: correctly define v4.2 support attributes ("J. Bruce Fields") [1079385] - [fs] nfsd: Add DEALLOCATE support ("J. Bruce Fields") [1079385] - [fs] nfsd: Add ALLOCATE support (Steve Dickx(XXO $mi@fedoraproject.org> 7.1.0-0.13.RC6Remi Collet 7.1.0-0.12.RC5Remi Collet 7.1.0-0.11.RC4Remi Collet 7.1.0-0.10.RC3Remi Collet 7.1.0-0.9.RC3Remi Collet 7.1.0-0.8.RC2Remi Collet 7.1.0-0.8.RC1Remi Collet 7.1.0-0.7.beta2Remi Collet 7.1.0-0.6.beta1Remi Collet 7.1.0-0.5.alpha3Remi Collet 7.1.0-0.4.alpha2Remi Collet 7.1.0-0.3.alpha2Remi Collet 7.1.0-0.2.alpha2Remi Collet 7.1.0-0.1.alpha1Remi Collet 7.0.7-1Remi Collet 7.0.7-0.1.RC1Remi Collet 7.0.6-3Remi Collet 7.0.6-2Remi Collet 7.0.6-0.2.RC1Remi Collet 7.0.5-2Remi Collet 7.0.5-1Remi Collet 7.0.5-0.1.RC1Remi Collet 7.0.4-2Remi Collet 7.0.4-1Remi Collet 7.0.4-0.1.RC1Remi Collet 7.0.3-1Remi Collet 7.0.3-0.3.20160129gitdd3d10cRemi Collet 7.0.3-0.2.RC1Remi Collet 7.0.3-0.1.RC1Remi Collet 7.0.2-1Remi Collet 7.0.2-0.1.RC1Remi Collet 7.0.1-1Remi Collet 7.0.1-0.1.RC1Remi Collet 7.0.0-2Remi Collet 7.0.0-1Remi Collet 7.0.0-0.26.RC8Remi Collet 7.0.0-0.25.RC8Remi Collet 7.0.0-0.24.RC7Remi Collet 7.0.0-0.23.RC7Remi Collet 7.0.0-0.22.RC6Remi Collet 7.0.0-0.21.RC5Remi Collet 7.0.0-0.20.RC5Remi Collet 7.0.0-0.19.RC5Remi Collet 7.0.0-0.18.RC4Remi Collet 7.0.0-0.17.RC3Remi Collet 7.0.0-0.16.RC3Remi Collet 7.0.0-0.15.RC2Remi Collet 7.0.0-0.14.RC1Remi Collet 7.0.0-0.13.beta3Remi Collet 7.0.0-0.12.beta2Remi Collet 7.0.0-0.11.beta1Remi Collet 7.0.0-0.10.alpha2Remi Collet 7.0.0-0.9.20150617git3697f02Remi Collet 7.0.0-0.9.20150611git8cfe282Remi Collet 7.0.0-0.8.alpha1Remi Collet 7.0.0-0.7.20150602git8a089e7Remi Collet 7.0.0-0.7.20150525git6f46fa3Remi Collet 7.0.0-0.6.20150525git404360fRemi Collet 7.0.0-0.6.20150518gitcee8857Remi Collet 7.0.0-0.6.20150515gitc9f27eeRemi Collet 7.0.0-0.6.20150507gitdd0b602Remi Collet 7.0.0-0.5.20150428git94f0b94Remi Collet 7.0.0-0.5.20150427git1a4d3e4Remi Collet 7.0.0-0.5.20150418git1f0a624Remi Collet 7.0.0-0.5.20150416gitc77d97fRemi Collet 7.0.0-0.5.20150403gitadcf0c6Remi Collet 7.0.0-0.4.20150331git463ca30Remi Collet 7.0.0-0.3.20150325git2fe6acdRemi Collet 7.0.0-0.2.20150325git23336d7Remi Collet 7.0.0-0.1.20150325git23336d7Remi Collet 5.6.7-1Remi Collet 5.6.7-0.1.RC1Remi Collet 5.6.6-1Remi Collet 5.6.5-1Remi Collet 5.6.5-0.2.RC1Remi Collet - 7.3.33-14Remi Collet - 7.3.33-13Remi Collet - 7.3.33-12Remi Collet - 7.3.33-11Remi Collet - 7.3.33-10Remi Collet - 7.3.33-9Remi Collet - 7.3.33-8Remi Collet - 7.3.33-7Remi Collet - 7.3.33-6Remi Collet - 7.3.33-5Remi Collet - 7.3.33-3Remi Collet - 7.3.33-2Remi Collet - 7.3.33-1Remi Collet - 7.3.32-1Remi Collet - 7.3.31-2Remi Collet - 7.3.31-1Remi Collet - 7.3.30-1Remi Collet - 7.3.29-1Remi Collet - 7.3.28-2Remi Collet - 7.3.28-1Remi Collet - 7.3.27-2Remi Collet - 7.3.27-1Remi Collet - 7.3.26-2Remi Collet - 7.3.26-1Remi Collet - 7.3.26~RC1-1Remi Collet - 7.3.25-1Remi Collet - 7.3.25~RC1-1Remi Collet - 7.3.24-1Remi Collet - 7.3.24~RC1-2Remi Collet - 7.3.24~RC1-1Remi Collet - 7.3.23-1Remi Collet - 7.3.23~RC1-1Remi Collet - 7.3.22-1Remi Collet - 7.3.22~RC1-1Remi Collet - 7.3.21-1Remi Collet - 7.3.21~RC1-1Remi Collet - 7.3.20-1Remi Collet - 7.3.20~RC1-2Remi Collet - 7.3.20~RC1-1Remi Collet - 7.3.19-1Remi Collet - 7.3.19~RC1-1Remi Collet - 7.3.18-1Remi Collet - 7.3.18~RC1-1Remi Collet - 7.3.17-1Remi Collet - 7.3.17~RC1-1Remi Collet - 7.3.16-1Remi Collet - 7.3.16~RC1-1Remi Collet - 7.3.15-1Remi Collet - 7.3.15~RC1-1Remi Collet - 7.3.14-1Remi Collet - 7.3.14~RC1-1Remi Collet - 7.3.13-1Remi Collet - 7.3.13~RC1-1Remi Collet - 7.3.12-1Remi Collet - 7.3.12~RC1-1Remi Collet - 7.3.11-1Remi Collet - 7.3.11~RC1-1Remi Collet - 7.3.10-1Remi Collet - 7.3.10~RC1-2Remi Collet - 7.3.10~RC1-1Remi Collet - 7.3.9-1Remi Collet - 7.3.9~RC1-1Remi Collet - 7.3.8-1Remi Collet - 7.3.8~RC1-1Remi Collet - 7.3.7-3Remi Collet - 7.3.7-2Remi Collet - 7.3.7-1Remi Collet - 7.3.7~RC3-1Remi Collet - 7.3.7~RC2-1Remi Collet - 7.3.7~RC1-2Remi Collet - 7.3.7~RC1-1Remi Collet - 7.3.6-2Remi Collet - 7.3.6-1Remi Collet - 7.3.6~RC1-2Remi Collet - 7.3.6~RC1-1Remi Collet - 7.3.5-2Remi Collet - 7.3.5-1Remi Collet - 7.3.5~RC1-1Remi Collet - 7.3.4-3Remi Collet - 7.3.4-2Remi Collet - 7.3.4-1Remi Collet - 7.3.4~RC1-2Remi Collet - 7.3.4~RC1-1Remi Collet - 7.3.3-1Remi Collet - 7.3.3~RC1-2Remi Collet - 7.3.3~RC1-1Remi Collet - 7.3.2-3Remi Collet - 7.3.2-2Remi Collet - 7.3.2-1Remi Collet - 7.3.2~RC1-1Remi Collet 7.3.1-3Remi CoxXXT($KE?Hd # I '=kqx              \ 4(8 +9+:+B~G H I XY ZD[H\P ] ^bdef!l#t< ul vw x y8DX\t   ghClibjpeg-turbo-devel1.2.908.el7Headers for the libjpeg-turbo libraryThis package contains header files necessary for developing programs which will manipulate JPEG files using the libjpeg-turbo library.]Lx86-01.bsys.centos.org5CentOSIJGCentOS BuildSystem Development/Librarieshttp://sourceforge.net/projects/libjpeg-turbolinuxx86_6495zBu=}A큤]L]L]L]L]L]L]LLLLPPe9fd36fae960422966ab6d296b35d87edb552489f5d0e3661c6be9683abff5f33837256f1e9d0697755b1d67e891348708ff8d92251edc8cc104d44359b21f8b06711efd4ecf3af6f17ef0c9b2ca2dda9ced8aefd9a11b895378d4212fe2fea2c7424d1089e3f6b1cf0cb4ed5ba437f80a74b0a68c0c82afa9cbac96699c3bf8969974d16a666b2d0626e9f31f7ce1c9b69133e59c7ce5817dc0939f57ab5f95e131c2a2cef164f46874f059ff031d49f75430362e3400bb2a8df43cdfcc95c72e7d37af3b4defb60ad3bcb8bf4e4a9e4fc3f9342e619eee82b3c9db758da7ef3b52d6122f95245a4bf10ccc62fbb2ecbfad5b3c51496ee0a2385b6df905b8e632421141380b97ed3b7663aaeb59026fdb60ba49502345869c0b5f28e0842f9500d42436ac7636adf727b32d9ad7a1c2a06addcee085decdcdc710c398cac219libjpeg.so.62.1.0rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootlibjpeg-turbo-1.2.90-8.el7.src.rpmlibjpeg-devellibjpeg-devel(x86-64)libjpeg-turbo-devellibjpeg-turbo-devel(x86-64)pkgconfig(libjpeg)@@    /usr/bin/pkg-configlibjpeg-turbo(x86-64)libjpeg.so.62()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)1.2.90-8.el73.0.4-14.6.0-14.0-15.2-14.11.3\+@\ @[@RURkR@QQQQP9@PP@P@PP@OX@ON=@NNM@MlMQ0@M4/@Lʷ@L*@L@LYV@L-L-L-L+1L+1L+1L(LLLL%@LLL@LNikola Forró - 1.2.90-8Nikola Forró - 1.2.90-7Nikola Forró - 1.2.90-6Daniel Mach - 1.2.90-5Daniel Mach - 1.2.90-4Petr Hracek - 1.2.90-3Adam Tkac - 1.2.90-2Adam Tkac 1.2.90-1Adam Tkac 1.2.90-0.1.20130204svn922Adam Tkac 1.2.1-6Adam Tkac 1.2.1-5Adam Tkac 1.2.1-4Adam Tkac 1.2.1-3Fedora Release Engineering - 1.2.1-2Adam Tkac 1.2.1-1Adam Tkac 1.2.0-1Fedora Release Engineering - 1.1.1-4Orion Poplawski 1.1.1-3Orion Poplawski 1.1.1-2Adam Tkac 1.1.1-1Adam Tkac 1.1.0-2Adam Tkac 1.1.0-1Fedora Release EngixqXW`$oKx?Hd # ?Ir ~9  ( t     h  , T  ; ;X;()*+,-8X9 X:SX=ħ>į?ķ@ĿDGHIhX|Yń\Ŭ]^b>def l (,X\l_ _ *TXlgphtCphp56-php-fpm5.6.4041.el7.remiPHP FastCGI Process ManagerPHP-FPM (FastCGI Process Manager) is an alternative PHP FastCGI implementation with some additional features useful for sites of any size, especially busier sites.f`({builder.remirepo.netDRemi's RPM repository #StandWithUkrainePHP and Zend and BSD and MIT and ASL 1.0Remi ColletDevelopment/Languageshttp://www.php.net/linuxx86_64# Add the "apache" user (to avoid pulling httpd in our dep) getent group apache >/dev/null || \ groupadd -g 48 -r apache getent passwd apache >/dev/null || \ useradd -r -u 48 -g apache -s /sbin/nologin \ -d /usr/share/httpd -c "Apache" apache exit 0 if [ $1 -eq 1 ] ; then # Initial installation systemctl preset php56-php-fpm.service >/dev/null 2>&1 || : fi if [ $1 -eq 0 ] ; then # Package removal, not upgrade systemctl --no-reload disable php56-php-fpm.service > /dev/null 2>&1 || : systemctl stop php56-php-fpm.service > /dev/null 2>&1 || : fi systemctl daemon-reload >/dev/null 2>&1 || : if [ $1 -ge 1 ] ; then # Package upgrade, not uninstall systemctl try-restart php56-php-fpm.service >/dev/null 2>&1 || : fi # Handle upgrading from SysV initscript to native systemd unit. # We can tell if a SysV version of php-fpm was previously installed by # checking to see if the initscript is present.( <KrC<ZL<8*<((((A큤A큤A큤A큤A큤AAAA큤f`'f`'f`'f`'f`'f`'f`'f`(if`'f`'f`'f`(if`'f`'f`'f`'f`'f`'f`'c0c8e4399ffe0cb98d0d6e265d035dce5023c707c25fc1f3d4d1dd68b77635ee64eb3c2fa3302d0a4bffeaf7c69c364ad959412542b157fb2f63299798b1aa7de001c96c2e6b21cc3298b926a57d0040e4335be8aeb1cc17a9955c1cd657e85bd8df7745f51ae5a41aaf7babae4ed0d41dd543039efcbdb08fdb81f5e3613aaa64d61f0afac19ac2bba7cd358e12e02e6cd7b3eccb3f4d5f186e12b8e135f4e5f745ad17f9c0b6ccf36ed9224f81b267576d82fef2acb3b157963a6a1ac92e088d88837894d8e0a55a5b275e19c3e02d86d11cb25e592f3a0d1ef464c84fe00028b9b14401f49784efd2246b32f745c2cd998f4f425be677f29e02a33e68bfed5cdce8a17e8237df0604f8468d43574b7255218eba7df05e5c83d6006ebcc64eedae1f8382cb8dd3dcc8313278b18adc700025f3d16741195e0160c4241a5e98rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootapacherootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootapacheapacherootrootrootphp56-php-5.6.40-41.el7.remi.src.rpmphp56-php-fpmphp56-php-fpm(x86-64)    @@@@@@@@@@@xaX{Wh 0F$VFEG6-3Jiri Skala - 20101006-2Jiri Skala - 20101006-1Jiri Skala - 20100418-3Jiri Skala - 20100418-2Jiri Skala - 20100418-1Jiri Skala - 20071127-10Fedora Release Engineering - 20071127-9Jiri Skala - 20071127-8Fedora Release Engineering - 20071127-7Jiri Skala - 20071127-6Jiri Skala - 20071127-5Jiri Skala - 20071127-4Martin Nagy - 20071127-3Martin Nagy - 20071127-2Martin Nagy - 20071127-1Martin Nagy - 20070202-9Martin Nagy - 20070202-8Martin Nagy - 20070202-7Martin Nagy - 20070202-6Martin Bacovsky - 20070202-5Martin Bacovsky - 20070202-4Martin Bacovsky - 20070202-3Martin Bacovsky - 20070202-2Martin Bacovsky - 20070202-1Martin Bacovsky - 20020927-42Radek Vokal - 20020927-41Martin Bacovsky - 20020927-40 Radek Vokal - 20020927-39Radek Vokal - 20020927-38Radek Vokál - 20020927-37Radek Vokál - 20020927-36Radek Vokál - 20020927-35Jesse Keating - 20020927-34.2Jesse Keating - 20020927-34.1Radek Vokál 20020927-34Radek Vokál 20020927-33Radek Vokal 20020927-32Jesse Keating Radek Vokal 20020927-31Radek Vokal 20020927-30Radek Vokal 20020927-29Radek Vokal 20020927-28Radek Vokal 20020927-27Radek Vokal 20020927-26Radek Vokal 20020927-25Radek Vokal 20020927-24Radek Vokal 20020927-23Radek Vokal 20020927-22Radek Vokal 20020927-21Radek Vokal 20020927-20Radek Vokal 20020927-19Radek Vokal Radek Vokal Elliot Lee Phil Knirsch 20020927-15Phil Knirsch 20020927-14Elliot Lee Phil Knirsch 20020927-12Phil Knirsch 20020927-11Bill Nottingham 20020927-10Phil Knirsch 20020927-9.1Phil Knirsch 20020927-9Phil Knirsch 20020927-8Phil Knirsch 20020927-7Elliot Lee Phil Knirsch 20020927-5Phil Knirsch 20020927-4Phil Knirsch 20020927-3Tim Powers 20020927-2Phil Knirsch 20020927-1Tim Powers 20020124-8Phil Knirsch 20020124-7Tim Powers Phil Knirsch Bill Nottingham Phil Knirsch Phil Knirsch Tim Powers Philipp Knirsch 20001110-6Philipp Knirsch Philipp Knirsch Philipp Knirsch Preston Brown Jeff Johnson Jeff Johnson Tim Waugh Tim Waugh Jeff Johnson Jakub Jelinek Prospector Jeff Johnson Jeff Johnson Jeff Johnson Jeff Johnson Elliot Lee Jeff Johnson JeffxPXSW0 P $Wupport checking separate debuginfo files - strip: fix ET_REL debuginfo files (#156341)- fix some bugs in new code, reenable make check- disable make check for most arches, for now- update to 0.106- update to 0.104- update to 0.103- update to 0.101. - use %configure macro to get CFLAGS etc. right- upgrade to 0.99.- upgrade to 0.97.- upgrade to 0.96.- rebuilt with GCC 3.4.x, workaround VLA + alloca mixing warning- rebuilt- upgrade to 0.95.- rebuilt- rebuilt- upgrade to 0.94- upgrade to 0.93- full version - macroized spec file for GPL or OSL builds - include only libelf under GPL plus wrapper scripts- macroized spec file for GPL or OSL builds- split elfutils-devel into two packages.- include only libelf under GPL plus wrapper scripts- readelf, not readline, in %description (#111214).- update to 0.89 (fix eu-strip)- update to 0.86 (fix eu-strip on s390x/alpha) - libebl is an archive now; remove references to DSO- upgrade to 0.84 (readelf/elflint improvements, rawhide bugs fixed).- upgrade to 0.83 (fix invalid ELf handle on *.so strip, more).- upgrade to 0.82 (strip tests fixed on big-endian).- upgrade to 0.81 (strip excludes unused symtable entries, test borked).- upgrade to 0.80 (debugedit changes for kernel in progress).- rebuilt- upgrade to 0.79 (correct formats for size_t, more of libdw "works").- upgrade to 0.78 (libdwarf bugfix, libdw additions).- debuginfo rebuild- use the correct way of identifying the section via the sh_info link.- update to 0.75 (eu-strip -g fix)- update to 0.74 (fix for writing with some non-dirty sections)- another -0.73 update (with sparc fixes). - do "make check" in %check, not %install, section.- update to 0.73 (with s390 fixes).- rebuilt- fix arguments to gelf_getsymshndx and elf_getshstrndx - fix other warnings - reenable checks on s390x- temporarily disable checks on s390x, until someone has time to look at it- update to 0.72- update to 0.71- update to 0.69. - add "make check" and segfault avoidance patch. - elfutils-libelf needs to run ldconfig.- update to 0.68.- update to 0.67.- update to 0.65.- update to 0.64.- split packages further into elfutils-libelf- update to 0.63.- Adjust for dropping libtool- update to 0.59- update to 0.56- update to 0.54- update to 0.53 - drop x86_64 hack, ICE fixed in gcc-3.2-11.- get beehive to punch a rhpkg generated package.- build in 8.0.1. - x86_64: avoid gcc-3.2 ICE on x86_64 for now.- Add libelf-devel to conflicts for elfutils-devel- Split into runtime and devel package- integrate into official sources- Swaddle./sbin/ldconfig/sbin/ldconfig  !"#$%&0.176-5.el70.176-5.el7elfutilslibebl_aarch64-0.176.solibebl_aarch64.solibebl_alpha-0.176.solibebl_alpha.solibebl_arm-0.176.solibebl_arm.solibebl_bpf-0.176.solibebl_bpf.solibebl_i386-0.176.solibebl_i386.solibebl_ia64-0.176.solibebl_ia64.solibebl_m68k-0.176.solibebl_m68k.solibebl_ppc-0.176.solibebl_ppc.solibebl_ppc64-0.176.solibebl_ppc64.solibebl_riscv-0.176.solibebl_riscv.solibebl_s390-0.176.solibebl_s390.solibebl_sh-0.176.solibebl_sh.solibebl_sparc-0.176.solibebl_sparc.solibebl_tilegx-0.176.solibebl_tilegx.solibebl_x86_64-0.176.solibebl_x86_64.solibasm-0.176.solibasm.so.1libdw-0.176.solibdw.so.1elfutils-libs-0.176COPYING-GPLV2COPYING-LGPLV3/usr/lib64//usr/lib64/elfutils//usr/share/licenses//usr/share/licenses/elfutils-libs-0.176/-O2 -g -pipe -Wall -Wp,x?XVn$~nm+ \? @d   5 $*1Nx  a (89:X <Y Hb gd e f l   $ P T d_  _  " L Pg Th XCphp565.61.el7.remiPackage that installs PHP 5.6This is the main package for php56 Software Collection, that install PHP 5.6 language.debuilder.remirepo.netRemi's RPM repository #StandWithUkraineGPL-2.0-or-laterRemi ColletDevelopment/Languageslinuxx86_64php56-5.6-1.el7.remi.src.rpmscl-package(php56)php56php56(x86-64)     php56-runtimephp56-php-common(x86-64)php56-php-cli(x86-64)php56-php-pearphp56-runtime(x86-64)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)5.6.311:1.10.55.6-1.el7.remi4.6.0-14.0-13.0.4-15.2-14.11.3d@\mA@\E@[@YXVaV@V@VEU@TPTuT @SS9XS0@Rb@RRRRRR8D@Q@Remi Collet 5.6-1Remi Collet 3.0-1Remi Collet 2.3-3Remi Collet 2.3-2Remi Collet - 2.3-1Remi Collet - 2.2-1Remi Collet 2.1-5Remi Collet 2.1-4Remi Collet 2.1-3Remi Collet 2.1-2Remi Collet 2.1-1Remi Collet 2.0-3Remi Collet 2.0-2Remi Collet 2.0-1Remi Collet 1.0-1Honza Horak - 1.1-7Remi Collet 1.1-6Remi Collet 1.1-5Remi Collet 1.1-4Remi Collet 1.1-2Remi Collet 1.1-1Remi Collet 1-1.5Remi Collet 1-1- define %scl_vendor and %_scl_prefix in macros.php56-config - redefine %__phpize and %__phpconfig - move man page out of scl tree - improve the man page- add syspaths sub package providing system-wide wrappers- cleanup for EL-8- scl-utils 2.0.2 drop modules support- add symlinks for /etc/opt/remi/php56 and /var/opt/remi/php56- use rh_layout on F26- add module file for EL- fix override for pecl_xmldir (F24)- add missing "sbin" in PATH (Fedora)- fix selinux context- fix licenses location - own directories for pecl packages- add environement module file- add LD_LIBRARY_PATH in enable script for embedded- provides php56-runtime(remi) - add _sclreq macro- initial packaging from php55 from rhscl 1.1 - install macro in /usr/lib/rpm/macros.d - each package requires runtime (for license)- Fix path typo in README Related: #1061455- own locale and man directories, #1074337- avoid empty debuginfo subpackage - add LICENSE, README and php55.7 man page #1061455 - add scldevel subpackage #1063357- rebuild with latest scl-utils #1054731- fix scl_package_override- build for RHSCL 1.1- add macros.php55-build for scl_package_override- initial packaging5.6-1.el7.remi5.6-1.el7.remi-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuhttps://forum.remirepo.net/?dJ=QŶ/]!LΈJ]NoGVd NoGV3r+Wq54z,2aX`wgx(_\]!LΈJ]NoGVd NoGV<4#Bðxc3k9XyUjv[IaB[Ӂbӗc33a85fe556bxp/XWB$.rian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Nalin Dahyabhai Florian La Roche Florian La Roche Tim Powers Trond Eivind Glomsrød Florian La Roche Trond Eivind Glomsrød Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Florian La Roche Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Florian La Roche Nalin Dahyabhai Nalin Dahyabhai Nalin Dahyabhai Florian La Roche Bill Nottingham Prospector Florian La Roche Florian La Roche Florian La Roche Than Ngo Florian La Roche Preston Brown Bill Nottingham Bill Nottingham Florian La Roche Florian La Roche Bill Nottingham Bill Nottingham Cristian Gafton Bernhard Rosenkränzer Bill Nottingham Florian La Roche Cristian Gafton Jeff Johnson Jeff Johnson Bill Nottingham Bill Nottingham Cristian Gafton Cristian Gafton Cristian Gafton Cristian Gafton Jeff Johnson Cristian Gafton Jeff Johnson Cristian Gafton Jeff Johnson Cristian Gafton Cristian Gafton Michael K. Johnson Michael K. Johnson Jeff Johnson Prospector System Cristian Gafton Cristian Gafton Donnie Barnes Donnie Barnes Donnie Barnes Donnie Barnes Erik Troan Donnie Barnes Donnie Barnes Donnie Barnes Donnie Barnes Erik Troan Erik Troan Erik Troan Erik Troan - Use SSL_CTX_use_certificate_chain_file() to handle intermediate certificates passed additionally in confSERVER_CERT Resolves: rhbz#1596725- Explicitly enabled sm-client statistics Resolves: rhbz#890585 - Enable ECDHE support Resolves: rhbz#1124827 - Properly set {client_port} value on little endian machines, patch by Kelsey Cumminngs Resolves: rhbz#1210914 - Added makemap and its manual page into alternatives Resolves: rhbz#1225891 - Modified nm-dispatcher script to asynchronously restart sendmail and not block the connection activation Resolves: rhbz#1237070 - Added config options axXVP O j$LjjjPR libgomp/58691)- update from the 4.8 branch - PRs ada/51483, ada/60703, c/37743, c/59891, c/60101, c++/37140, c++/41174, c++/54652, c++/55800, c++/57043, c++/57524, c++/57899, c++/58466, c++/58504, c++/58606, c++/58632, c++/58639, c++/58672, c++/58812, c++/58814, c++/58835, c++/58837, c++/58845, c++/58873, c++/58965, c++/59097, c++/59224, c++/59646, c++/59989, c++/60108, c++/60146, c++/60182, c++/60187, c++/60216, c++/60219, c++/60248, debug/59776, fortran/49397, fortran/52370, fortran/55907, fortran/57033, fortran/58007, fortran/58803, fortran/59395, fortran/59414, fortran/59599, fortran/59700, fortran/59906, fortran/60231, fortran/60283, fortran/60341, fortran/60450, fortran/60522, fortran/60543, fortran/60576, fortran/60677, ipa/55260, ipa/60026, ipa/60419, ipa/60640, libfortran/38199, libfortran/58324, libfortran/59700, libfortran/59764, libfortran/59771, libfortran/59774, libfortran/59836, libfortran/60128, libgcc/60166, libgcj/55637, libstdc++/59215, libstdc++/59392, libstdc++/59548, libstdc++/59680, libstdc++/59738, libstdc++/60564, libstdc++/60658, middle-end/57499, middle-end/58809, middle-end/60004, middle-end/60221, middle-end/60291, objc/56870, other/56653, preprocessor/56824, preprocessor/58844, preprocessor/60400, rtl-optimization/56356, rtl-optimization/57422, rtl-optimization/57425, rtl-optimization/57569, rtl-optimization/57637, rtl-optimization/60116, rtl-optimization/60452, rtl-optimization/60601, rtl-optimization/60700, target/43546, target/48094, target/54083, target/54407, target/55426, target/56843, target/57052, target/57935, target/57949, target/58675, target/58710, target/59054, target/59379, target/59396, target/59462, target/59718, target/59777, target/59844, target/59880, target/59909, target/59929, target/60017, target/60032, target/60039, target/60062, target/60151, target/60193, target/60203, target/60207, target/60486, target/60568, target/60735, tree-optimization/56490, tree-optimization/59903, tree-optimization/60115, tree-optimization/60183, tree-optimization/60276, tree-optimization/60382, tree-optimization/60429, tree-optimization/60454, tree-optimization/60485 - powerpc64 little endian support - enable ppc64le in the spec file- fix up compare_exchange_* in libatomic too (PR c++/60272)- fix exception spec instantiation ICE (#1067398, PR c++/60046) - fix pch on aarch64 (#1058991, PR pch/60010) - configure with --enable-gnu-indirect-function on architectures and distros that support it and don't support it by default yet (#1067245) - fix vector permutation handling on i?86/x86_64 (PR target/57896) - fix __atomic_compare_exchange_* not to store into *expected on success (PR c++/60272) - fix -march=native on VMs where saving/restoring of YMM state is not supported, yet CPU supports f16c (PR driver/60233) - add ref7.C testcase (PR c++/60274)- remove libgo P.224 elliptic curve (#1066539) - fix -mcpu=power8 ICE (#1064242, PR target/60137)- when removing -Wall from CXXFLAGS, if -Werror=format-security is present, add -Wformat to it, so that GCC builds on F21- update from the 4.8 branch (#1052892) - PRs c++/59838, debug/54694, fortran/34547, fortran/58410, middle-end/59827, middle-end/59860, target/58139, target/59142, target/59695, target/59794, target/59826, target/59839 - fix handling of initialized vars with flexible array members (#1035413, PR middle-end/28865)- update from the 4.8 branch - fix s390x reload bug (#1052372, PR target/59803)- update from the 4.8 branch (#1052892) - PRs ada/55946, ada/59772, c++/56060, c++/58954, c++/59255, c++/59730, fortran/57042, fortran/58998, fortran/59493, fortran/59612, fortran/59654, ipa/59610, middle-end/59584, pch/59436, rtl-optimization/54300, rtl-optimization/58668, rtl-optimization/59137, rtl-optimization/59647, rtl-optimization/59724, target/57386, target/59587, target/59625, target/59652, testsuite/58630, tree-optimization/54570, tree-optimization/59125, tree-optimization/59362, tree-optimization/59715, tree-optimization/59745 - default to -max`XWp̃$\̃˃=?d # O(,DH     f hpz,9(w879\7:t7GHIXY$\H]P^dbdpeufxlz_ 7_ ghCphp80-php-imap8.0.306.el7.remiA module for PHP applications that use IMAPThe php80-php-imap module will add IMAP (Internet Message Access Protocol) support to PHP. IMAP is a protocol for retrieving and uploading e-mail messages on mail servers. PHP is an HTML-embedded scripting language.f_0builder.remirepo.netNRemi's RPM repository #StandWithUkrainePHPRemi ColletUnspecifiedhttp://www.php.net/linuxx86_64. f_/f_/a8730d0067b475e4f7b57eee8338cdbdbfbbec7336ac6bf3a4c1a2acfaa5aab461caa2b566c0259248d71ec416c78c440e900efcda071133064706fa596b77a3rootrootrootrootphp80-php-8.0.30-6.el7.remi.src.rpmphp80-php-imapphp80-php-imap(x86-64)   @@@@@@@@@@@@@@@@ php80-php-common(x86-64)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)libc-client.so.2007()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcom_err.so.2()(64bit)libcrypt.so.1()(64bit)libcrypto.so.10()(64bit)libgssapi_krb5.so.2()(64bit)libk5crypto.so.3()(64bit)libkrb5.so.3()(64bit)libpam.so.0()(64bit)libssl.so.10()(64bit)rtld(GNU_HASH)rpmlib(PayloadIsXz)8.0.30-6.el7.remi4.6.0-14.0-13.0.4-15.2-14.11.3f_f@eZexK@e 0@d˖dd\dBzc@cwcc~ @ck@cWcEZc47@c!@c b@bbb֜by@b'bb@bb@bzSbgbV@bEb0b\@b@b @aaaՈ@a*@a@a@aayawawan@amaa]aKa7T@a$@aaj@a /a@`@` @`Ȗ@`r`O@`}@```u`P`?z@`.V`>`@`_T_T_إ@_j_G@_ __ _@_ts@_cO_a@_O@_FN_=@_5+@_*@__X@__c^^@@^@@^b^y^(@^?@^V@^V@^^^@^@^@^^^@^@^1^@^_^@^0^p^^F^K^9\^0"@^&^r]]@]e@]M@])]]@]@]]]n]@](]4@]?]@]]]nU][]Ik]8H@]6](v@]$] ]]@]@]@\\t@\"\9\@\@\\@\ڭ\Ɋ@\Ɋ@\\C@\@\N\|\\~d\o@\k\j@\\\Yz\G\@n@\?\4\@\l@[@[@[0[ @[@[#@[@["@[9@[9@[ug@[M@[;e@[+@[(@[@[[WZz@Z(Z@ZZlZ2@Z`@Z@Z$U2G@U/@UU@U@U@U@U @T9T@TTC@TTp@T5Tw@TuThTd@TVT?@T.Tk@SSSr @S,)S?SR@R@R@RRRRR_@R:@RQ@QY@QY@QQQ@Q@QQyQfQ@j@P@PѬ@PP@P@P*P@P@P)P)PPPPPP5@P{Px@Pl(Pj@PiPiPe@P`K@PYPYPYPXb@PWPS@P2&P.2@P H@O@O@O O@O\@Os@O@O@OvOtNOpZ@OpZ@OP@O?O-xXW` v$$vv){dh:ÃKz)1kÛ<{'m\ r/Lы Da>|lX M7j']OO&ijBp#Հi IkX1$ƨm+iX^ l@ _)\{X+9?UkEuI-LyN=-ղp笐HDXL!$?5.'G8o-%du=ʷo͒xI-+%rĹ繏Y2t: wZ_+qضRл3qNA1nGC2[7l /Uq/0$/=P6mal)Ɓ zž]#t6tmX+p&ֶqQY-د7`McϓDF ^v %>'Σ#0qpl뾤FuP/Q@~w $eӰfdBTC0kVk?c@R$f}Jnw(¾ni3j+BV-' `UnI-M35Ίi A ,wh3V lRm֜yt-uJ$ba3de421333b2001aac3530cd6d5ed6d8fa0c353b b #8:"s- U (f r [ *^z]t5  |y nV .     b     1  o lT% * ] f, % v&P@6  7!oXUXru*H]#"SQ _& X w ( {$ w)&4PDy-v% % dQLk+|A큤A큤A큤AA큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤AA큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤x@XX ȯ $> 5.3.8-1Remi Collet 5.3.7-1Joe Orton - 5.3.6-4Remi Collet 5.3.6-3Remi Collet 5.3.6-2Remi Collet 5.3.6-1Joe Orton - 5.3.5-6Caolán McNamara 5.3.5-5Remi Collet 5.3.5-4Remi Collet 5.3.5-3Fedora Release Engineering - 5.3.5-2Remi Collet 5.3.5-1Remi Collet 5.3.4-2Remi Collet 5.3.4-1.1Remi Collet 5.3.4-1Remi Collet 5.3.3-5Joe Orton - 5.3.3-4Joe Orton - 5.3.3-3Remi Collet 5.3.3-2Remi Collet 5.3.3-1Remi Collet 5.3.2-3Caolán McNamara 5.3.2-2Remi Collet 5.3.2-1Joe Orton - 5.3.1-3Joe Orton - 5.3.1-2Remi Collet 5.3.1-1Tom "spot" Callaway - 5.3.0-7Tomas Mraz - 5.3.0-6Fedora Release Engineering - 5.3.0-5Joe Orton 5.3.0-4Joe Orton 5.3.0-3Joe Orton 5.3.0-2Remi Collet 5.3.0-1Remi Collet 5.2.10-1Remi Collet - 5.2.9-1Fedora Release Engineering - 5.2.8-10Joe Orton 5.2.8-9Joe Orton 5.2.8-8Joe Orton 5.2.8-7Joe Orton 5.2.8-5Joe Orton 5.2.8-4Joe Orton 5.2.8-3Remi Collet 5.2.8-2Remi Collet 5.2.8-1Remi Collet 5.2.7-1.1Remi Collet 5.2.7-1Joe Orton 5.2.6-7Joe Orton 5.2.6-6Remi Collet 5.2.6-5Remi Collet 5.2.6-4Joe Orton 5.2.6-3Joe Orton 5.2.5-7Fedora Release Engineering - 5.2.5-6Joe Orton 5.2.5-5Joe Orton 5.2.5-4Release Engineering - 5.2.5-3Joe Orton 5.2.5-2Joe Orton 5.2.4-3Joe Orton 5.2.4-2Joe Orton 5.2.3-9Joe Orton 5.2.3-8Hans de Goede 5.2.3-7Joe Orton 5.2.3-6Joe Orton 5.2.3-5Joe Orton 5.2.3-4Joe Orton 5.2.3-3Joe Orton 5.2.3-2Joe Orton 5.2.2-4Joe Orton 5.2.2-3Joe Orton 5.2.2-2Joe Orton 5.2.1-5Joe Orton 5.2.1-4Joe Orton 5.2.1-3Joe Orton 5.2.1-2Joe Orton 5.2.0-10Joe Orton 5.2.0-9Joe Orton 5.2.0-8Joe Orton 5.2.0-7Joe Orton 5.2.0-6Joe Orton 5.2.0-5Joe Orton 5.2.0-4Joe Orton 5.2.0-3Joseph Orton 5.1.6-4Joe Orton 5.1.6-3Joe Orton 5.1.6-2Jesse Keating - 5.1.4-8.1Joe Orton 5.1.4-8Joe Orton 5.1.4-7Joe Orton 5.1.4-6Radek Vokal 5.1.4-5.1Joe Orton 5.1.4-5Joe Orton 5.1.4-3Joe Orton 5.1.3-3Joe Orton 5.1.2-5Jesse Keating - 5.1.2-4.3Jesse Keating 0- Add pam_selinux to pam file to allow switching of roles within selinux- The textutils-2.0.17-mem.patch is no longer needed.- Fixed autoconf test causing builds to fail.- Fix copying to non xattr files- Fix column widths problems in ls.- Speed up md5sum by disabling speed-up asm.- Try again- Fix0XUxa$=aaa7c6c4d9b23e611d66ff9f48f8ea6c832cefc626cf25cca1b9b4ed3fdbc3120a0246c40fa05d1ca9d80a6200a27b53e331ca4ea74f3df25f9f7e4722ce8b0eb8f2cfdcb5697c7814e09eaaec3e1651c48b219c9ca5b3880d71fce089c69cc6bcf2cfdcb5697c7814e09eaaec3e1651c48b219c9ca5b3880d71fce089c69cc6bc0c7d55e888ca3e9274b659fc6d8bf1bd0eea9ef646f94a10b4c039c9595e1e25d168367779c79d3bd33a8bbb8596a4e487a806ed1b79456d9953a411df8bb527c0867c336f3315c6b5071217e0a2e95ac0ece2e927a48e0b1417a6269b5e38524f0bf293916a56739e88d71b56cc8c0cf4c5d6636590a7f2a1f1bbb4ac53743f54e1029b443dab0734ee1640c593516a13a60187d92a8279cef517cc0f4da2f154e1029b443dab0734ee1640c593516a13a60187d92a8279cef517cc0f4da2f1f5d5f12199e4234f7961f1c2f9721a545e9ddf51a3798d4083c4c4cdc1607a9374086727a4cf3922c7988b4864040cc01799529ac3c003ad4c77a83f0253e29574086727a4cf3922c7988b4864040cc01799529ac3c003ad4c77a83f0253e295262a107916641c7f211ac5898c0177535cd0bdc5aa872cc6e883842694d8f52181a04af69c7f806ec39ab2cac5f0fa7fa8beb6802601105355fb3e606151405d7544ec8ed2db2be7de9aba2b52b4c617caaf2e3853893fe7e14a3957abbffc6bc0e0773a79dceb622ef6410577c19c1e177fb2eb9c623a49340de3c9f1de25606417e754ba5b06d00e7ffda009d890fb2ac11e646c37349ff150b75294192238c4f5e2e6274f71055bae183106a1764cd1a6eac499d9a2d5544b7a0d6ce994bf0c1e3a144018bfc056c1027ee51cc2ebde85c4f37b08e37e42c8be478a682607b34d31d2e3c349a6b90c727f0b0ce5561837395749e3b7f8ce0a9075dd1201f43454585a198ffea4f78c67d58d1ebe89a0be1107612058e25ed4cb37964f2a71e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855edf961e07e7fa9038a35ee50b85c918b42f6f890480a0277c7195713b32b5347be9c91bc27a1e602244aae682eba1d597be7f8057321dbcce1c42ba9ce59775fbe9c91bc27a1e602244aae682eba1d597be7f8057321dbcce1c42ba9ce59775fdf007e190a8473b8eaf8f63060041a3dbb53befafbb2d93f0d5999c4581e85f033ad3b8c935e21e1c6f419537ff8da4243c92389cec5224f9fece6100696e37323f587e2c070f55b3d67e06f9ae5d8d1ac3cb71f1abefeab9b950be12fe93f4d54a194f91dd461a6695535e5edc856978bc46040dea1bebd49fbd14d0f1aabfefa977b1cc6658ee65f15101b0808803ffd86d38a2b2132458fe4bd75dafaa3ceda3d759d94846778ae7acc7bc9cf9b483be88c8e7b6acc374ed143a6c8918ee2da3d759d94846778ae7acc7bc9cf9b483be88c8e7b6acc374ed143a6c8918ee2cc9adbfa9cfe5aed9d6709cda1d835bf7c3deb356aece46e37e84e18e1db740ff3bb40d1b3eecef76a9fe45c628833f0a1e86400d3b2131662becae324d35404474d742dfca6ccdfb4ec0ec0281f976cd5dbc749dab4cc4df91f483d3107cfe43b7339eff222b10fb35b9856db4bb191f9387d31acaf4105dad00ac77064b10abaef3341a110363c05cb02115cad90b1eee13e3e2d1dc7721e71d3cd8a6389c3baef3341a110363c05cb02115cad90b1eee13e3e2d1dc7721e71d3cd8a6389c3e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855956244421b9241c23e5bb9127abbfac4dd8b0e15f3df547a70c1b74e9eda3bfa956244421b9241c23e5bb9127abbfac4dd8b0e15f3df547a70c1b74e9eda3bfa92d8a4b8af5a838952e1ff19d24e69d45d75a85e343760223ad8db5e217dedec72bb2a6d3a4c57f0e361aa40a88cedf26ce6fbaea7322e1dcf30e2560100d26872bb2a6d3a4c57f0e361aa40a88cedf26ce6fbaea7322e1dcf30e2560100d268ebb6afad8a95d542bb8bfdb6828454aef27c49f7f38d17538daf70ceaff29d76b8ac1e46bdfaac8d8985e4ff4b7a57f092e20a678951515777648e32f88b7916b8ac1e46bdfaac8d8985e4ff4b7a57f092e20a678951515777648e32f88b7916691f593337e15750b6424df016c1af930c6ab5d3d376c255191b790d40b0809f39502287c67a9132b9cd73d9a02a3a7dd65fca755bdce5e05ecca5703eca11175a8add75f4a9958cc123842ce20d123bcda97b6b9d2496bf3b7cd3b249e005eea28432b30c1b6fef4de88562d4ac23b2cd5a47e2af9bc64d7b3a32544a27a7c78f061d2aa1799e519fc70098842bafe0184d1fd625f1e29f3af63876c587b0098f061d2aa1799e519fc70098842bafe0184d1fd625f1e29f3af63876c587b009a670064db2a175b0aaffdc8c669ee6f218f9abf349a72417ea840866e61c9e4c1d50852b78a7480fee33ea73c3a57b9126c1f9ee7d4027e1215af9e5ef9199af1d50852b78a7480fee33ea73c3a57b9126c1f9ee7d4027e1215af9e5ef9199af87ad5c8954dd56fbbca04517bf87477ff4dce575170c7dd1281d7ef1f4214ac818a26088860a46150c10880442d288b964c95acb9463d5c14117d707b202073518a26088860a46150c10880442d288b964c95acb9463d5c14117d707b2020735e9ae8fbf1fd1542f602070e414e55d44478669972438e89677b4fa1b2cd4dea5e46cc823f3a6accc7d9a344c49fdc3c86ba66c616ebcf7ab840b320637ca74f07f0a3b1ada21c376ebaff00b9b659c3fc2592bxX;X2 $ivilege_tables.1), removed "-n" from install section.- removed the GIF Icon (file was not included in the sources anyway) - removed unused variable shared_lib_version - do not run automake before building the standard binary (should not be necessary) - add server suffix '-standard' to standard binary (to be in line with the binary tarball distributions) - Use more RPM macros (_exec_prefix, _sbindir, _libdir, _sysconfdir, _datadir, _includedir) throughout the spec file. - allow overriding CC and CXX (required when building with other compilers)- re-enabled RAID again- disabled MyISAM RAID (--with-raid)- it throws an assertion which needs to be investigated first.- added missing file mysql_secure_installation to server subpackage (BUG 141)- re-added missing pre- and post(un)install scripts to server subpackage - added config file /etc/my.cnf to the file list (just for completeness) - make sure to create the datadir with 755 permissions- removed unusedql.com> - Reworked the build steps a little bit: the Max binary is supposed to include OpenSSL, which cannot be linked statically, thus trying to statically link against a special glibc is futile anyway - because of this, it is not required to make yet another build run just to compile the shared libs (saves a lot of time) - updated package description of the Max subpackage - clean up the BuildRoot directory afterwards- Updated Packager information - Fixed the build options: the regular package is supposed to include InnoDB and linked statically, while the Max package should include BDB and SSL support- Use more RPM macros (e.g. infodir, mandir) to make the spec file more portable - reorganized the installation of documentation files: let RPM take care of this - reorganized the file list: actually install man pages along with the binaries of the respective subpackage - do not include libmysqld.a in the devel subpackage as well, if we have a special "embedded" subpackage - reworked the package descriptions- Added embedded server as a separate RPM- Added mysqld-max to the distribution- Added mysql-test to the bench package- Added separate libmysql_r directory; now both a threaded and non-threaded library is shipped.- Added the support-files/my-example.cnf to the docs directory. - Removed devel dependency on base since it is about client development.- Cleaned up some for 3.23.- Added support for shared libraries in a separate sub package. Original fix by David Fox (dsfox@cogsci.ucsd.edu) - The --enable-assembler switch is now automatically disables on platforms there assembler code is unavailable. This should allow building this RPM on non i386 systems.- Removed unportable cc switches from the spec file. The defaults can now be overridden with environment variables. This feature is used to compile the official RPM with optimal (but compiler version specific) switches. - Removed the repetitive description parts for the sub rpms. Maybe add again if RPM gets a multiline macro capability. - Added support for a pt_BR translation. Translation contributed by Jorge Godoy .- A lot of changes in all the rpm and install scripts. This may even be a working RPM :-)- A developers changelog for MySQL is available in the source RPM. And there is a history of major user visible changed in the Reference Manual. Only RPM specific changes will be documented here.MySQL-clientmariadbmysqlpb2-el7-13.regionaliad02.mysql2iad.oraclevcn.com 1654680260 5.7.39-1.el75.7.39-1.el75.7.39-1.el75.7.39-1.el75.7.39-1.el75.7.39-1.el75.7.39-1.el7mysqlmysql_config_editormysqladminmysqlbinlogmysqlcheckmysqldumpmysqlimportmysqlpumpmysqlshowmysqx XW$e.3.7 http://www.php.net/ChangeLog-5.php#5.3.7 - merge php-zts into php (#698084)- rebuild for net-snmp SONAME bump- enable mhash extension (emulated by hash extension)- rebuild for new MySQL client library- update to 5.3.6 http://www.php.net/ChangeLog-5.php#5.3.6 - fix php-pdo arch specific requires- disable zip extension per "No Bundled Libraries" policy (#551513)- rebuild for icu 4.6- fix systemd-units requires- add tmpfiles.d configuration for php-fpm - add Arch specific requires/provides- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 5.3.5 http://www.php.net/ChangeLog-5.php#5.3.5 - clean duplicate configure options- rebuild against MySQL 5.5.8 - remove all RPM_SOURCE_DIR- security patch from upstream for #660517- update to 5.3.4 http://www.php.net/ChangeLog-5.php#5.3.4 - move phpize to php-cli (see #657812)- ghost /var/run/php-fpm (see #656660) - add filter_setup to not provides extensions as .so- use mysql_config in libdir directly to avoid biarch build failures- rebuild for new net-snmp- add php-fpm sub-package- PHP 5.3.3 released- garbage collector upstream patches (#580236)- rebuild for icu 4.4- PHP 5.3.2 Released! - remove mime_magic option (now provided by fileinfo, by emu) - add patch for http://bugs.php.net/50578 - remove patch for libedit (upstream) - add runselftest option to allow build without test suite- update to v7 of systzdata patch- fix build with autoconf 2.6x- update to 5.3.1 - remove openssl patch (merged upstream) - add provides for php-pecl-json - add prod/devel php.ini in doc- use libedit instead of readline to resolve licensing issues- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rediff systzdata patch- update to v6 of systzdata patch; various fixes- update to v5 of systzdata patch; parses zone.tab and extracts timezone->{country-code,long/lat,comment} mapping table- update to 5.3.0 - remove ncurses, dbase, mhash extensions - add enchant, sqlite3, intl, phar, fileinfo extensions - raise sqlite version to 3.6.0 (for sqlite3, build with --enable-load-extension) - sync with upstream "production" php.ini- update to 5.2.10 - add interbase sub-package- update to 5.2.9- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add recode support, -recode subpackage (#106755) - add -zts subpackage with ZTS-enabled build of httpd SAPI - adjust php.conf to use -zts SAPI build for worker MPM- fix patch fuzz, renumber patches- drop obsolete configure args - drop -odbc patch (#483690)- split out sysvshm, sysvsem, sysvmsg, posix into php-process- move wddx to php-xml, build curl shared in -common - remove BR for expat-devel, bogus configure option- rebuild for new MySQL- libtool 2 workaround for phpize (#476004) - add missing php_embed.h (#457777)- update to 5.2.8- libtool 2 workaround- update to 5.2.7 - enable pdo_dblib driver in php-mssql- tweak Summary, thanks to Richard Hughes- move gd_README to php-gd - update to r4 of systzdata patch; introduces a default timezone name of "System/Localtime", which uses /etc/localtime (#469532)- enable XPM support in php-gd - Fix BR for php-gd- enable T1lib support in php-gd- update to 5.2.6 - sync default php.ini with upstream - drop extension_dir from default php.ini, rely on hard-coded default, to make php-common multilib-safe (#455091) - update to r3 of systzdata patch- split pspell extension out into php-spell (#443857)- Autorebuild for GCC 4.3- ext/date: use system timezone database- rebuild for libc-client bump- Rebuild for openssl bump- update to 5.2.5- correct pcre BR version (#333021) - restore metaphone fix (#205714) - add READMEs to php-cli- update to 5.2.4- rebuild for fixed APR- add ldconfig post/postun for -embedded (Hans de Goede)- add php-embedded sub-package- fix build with new glibc - fix License- define php_extdir in macros.php- obsolete php-dbase- add mcrypt, mhash, tidy, mssql subpackages (Dmitry Butskoy) - enable dbase extension and package in -common- updxX 26LX/*jϴ}.[ts"@U.Q \9ȂXy>u0xXW[PAc$QAc@cBcton 5.2.1-4Joe Orton 5.2.1-3Joe Orton 5.2.1-2Joe Orton 5.2.0-10Joe Orton 5.2.0-9Joe Orton 5.2.0-8Joe Orton 5.2.0-7Joe Orton 5.2.0-6Joe Orton 5.2.0-5Joe Orton 5.2.0-4Joe Orton 5.2.0-3Joseph Orton 5.1.6-4Joe Orton 5.1.6-3Joe Orton 5.1.6-2Jesse Keating - 5.1.4-8.1Joe Orton 5.1.4-8Joe Orton 5.1.4-7Joe Orton 5.1.4-6Radek Vokal 5.1.4-5.1Joe Orton 5.1.4-5Joe Orton 5.1.4-3Joe Orton 5.1.3-3Joe Orton 5.1.2-5Jesse Keating - 5.1.2-4.3Jesse Keating - 5.1.2-4.1Joe Orton 5.1.2-4Joe Orton 5.1.2-3Joe Orton 5.1.2-2Joe Orton 5.1.1-8Joe Orton 5.1.1-7Joe Orton 5.1.1-6Jesse Keating Joe Orton 5.1.1-5Joe Orton 5.1.1-4Joe Orton 5.1.1-3Joe Orton 5.1.1-2Tomas Mraz 5.0.5-6Joe Orton 5.0.5-5Joe Orton 5.0.5-4Joe Orton 5.0.5-3Joe Orton 5.0.4-11Joe Orton 5.0.4-10Joe Orton 5.0.4-9Joe Orton 5.0.4-8Joe Orton 5.0.4-7Joe Orton 5.0.4-6Joe Orton 5.0.4-5Joe Orton 5.0.4-4Joe Orton 5.0.4-3Joe Orton 5.0.4-2Joe Orton 5.0.4-1Joe Orton 5.0.3-5Joe Orton 5.0.3-4Joe Orton 5.0.3-3Joe Orton 5.0.3-2Joe Orton 5.0.3-1Joe Orton 5.0.2-8Joe Orton 5.0.2-7Joe Orton 5.0.2-6Joe Orton 5.0.2-5Joe Orton 5.0.2-4Joe Orton 5.0.1-4Joe Orton 5.0.1-3Joe Orton 5.0.1-2Joe Orton 5.0.1-1Tom Callaway Tom Callaway - rebuild with gd 2.3.3 - myqlnd: fix #81719: mysqlnd/pdo password buffer overflow. CVE-2022-31626- FPM: Fix CVE-2019-11043 env_path_info underflow in fpm_main.c- Fix #77242 heap out of bounds read in xmlrpc_decode - Fix #77380 Global out of bounds read in xmlrpc base64 code- Fix #77231 Segfault when using convert.quoted-printable-encode filter - Fix #77020 null pointer dereference in imap_mail CVE-2018-19935 - Fix #77153 imap_open allows to run arbitrary shell commands via mailbox parameter CVE-2018-19158- fix #76582: XSS due to the header Transfer-Encoding: chunked- fix #73549: Use after free when stream is passed to imagepng - fix #75981: stack-buffer-overflow while parsing HTTP response- fix #73737: FPE when parsing a tag format CVE-2016-10158 - fix #73764: int overflows in phar CVE-2016-10159 - fix #73768: Memory corruption when loading hostile phar CVE-2016-10160 - fix #69090: check cached files permissions- fix #73631: Invalid read when wddx decodes empty boolean element CVE-2016-9935- fix #73418: Integer Overflow in "_php_imap_mail" leads Heap Overflow - fix #73144: Use-after-free in ArrayObject Deserialization - fix #73356: crash in bzcompress function - fix #73331: NULL Pointer Deref. in WDDX Packet Deserialization with PDORow CVE-2016-9934- fix #73189: Memcpy negative size parameter php_resolve_path - fix #72581: previous property undefined in Exception after deserialization - fix #73147: Use After Free in unserialize CVE-2016-9137 - xxyXL`P $   xG9GQzgABPrm6NDd1t9j7w1L7uwBvMB1wgpirRTPVfnUS Cd+025PEF+wTcBhfnzLtFj5xD7mNsmDmeHkF/sDfNOfAzTE1v2wq0ndYU60xbL6/ yl/Nipyr7WiQjCG0m3WfkjjVDTfs7/DXUqHFDOu4WMF9v+oqwpJXmAeGhQTWZC/Q hWtrjrNJAgwKpp263gDSdW70ekhRzsok1HJwX1SfxHJYCMFs2aH6ppzNsQARAQAB tDZNeVNRTCBSZWxlYXNlIEVuZ2luZWVyaW5nIDxteXNxbC1idWlsZEBvc3Mub3Jh Y2xlLmNvbT6JAlQEEwEIAD4WIQSFm+jXxYb1OEMLGcJGe5QtOnm9KQUCYbi6twIb AwUJA8JnAAULCQgHAgYVCgkICwIEFgIDAQIeAQIXgAAKCRBGe5QtOnm9KUewD/99 2sS31WLGoUQ6NoL7qOB4CErkqXtMzpJAKKg2jtBGG3rKE1/0VAg1D8AwEK4LcCO4 07wohnH0hNiUbeDck5x20pgS5SplQpuXX1K9vPzHeL/WNTb98S3H2Mzj4o9obED6 Ey52tTupttMF8pC9TJ93LxbJlCHIKKwCA1cXud3GycRN72eqSqZfJGdsaeWLmFmH f6oee27d8XLoNjbyAxna/4jdWoTqmp8oT3bgv/TBco23NzqUSVPi+7ljS1hHvcJu oJYqaztGrAEf/lWIGdfl/kLEh8IYx8OBNUojh9mzCDlwbs83CBqoUdlzLNDdwmzu 34Aw7xK14RAVinGFCpo/7EWoX6weyB/zqevUIIE89UABTeFoGih/hx2jdQV/NQNt hWTW0jH0hmPnajBVAJPYwAuO82rx2pnZCxDATMn0elOkTue3PCmzHBF/GT6c65aQ C4aojj0+Veh787QllQ9FrWbwnTz+4fNzU/MBZtyLZ4JnsiWUs9eJ2V1g/A+RiIKu 357Qgy1ytLqlgYiWfzHFlYjdtbPYKjDaScnvtY8VO2Rktm7XiV4zKFKiaWp+vuVY pR0/7Adgnlj5Jt9lQQGOr+Z2VYx8SvBcC+by3XAtYkRHtX5u4MLlVS3gcoWfDiWw CpvqdK21EsXjQJxRr3dbSn0HaVj4FJZX0QQ7WZm6WLkCDQRhuLq3ARAA6RYjqfC0 YcLGKvHhoBnsX29vy9Wn1y2JYpEnPUIB8X0VOyz5/ALv4Hqtl4THkH+mmMuhtndo q2BkCCk508jWBvKS1S+Bd2esB45BDDmIhuX3ozu9Xza4i1FsPnLkQ0uMZJv30ls2 pXFmskhYyzmo6aOmH2536LdtPSlXtywfNV1HEr69V/AHbrEzfoQkJ/qvPzELBOjf jwtDPDePiVgW9LhktzVzn/BjO7XlJxw4PGcxJG6VApsXmM3t2fPN9eIHDUq8ocbH dJ4en8/bJDXZd9ebQoILUuCg46hE3p6nTXfnPwSRnIRnsgCzeAz4rxDR4/Gv1Xpz v5wqpL21XQi3nvZKlcv7J1IRVdphK66De9GpVQVTqC102gqJUErdjGmxmyCA1OOO RqEPfKTrXz5YUGsWwpH+4xCuNQP0qmreRw3ghrH8potIr0iOVXFic5vJfBTgtcuE B6E6ulAN+3jqBGTaBML0jxgj3Z5VC5HKVbpg2DbB/wMrLwFHNAbzV5hj2Os5Zmva 0ySP1YHB26pAW8dwB38GBaQvfZq3ezM4cRAo/iJ/GsVE98dZEBO+Ml+0KYj+ZG+v yxzo20sweun7ZKT+9qZM90f6cQ3zqX6IfXZHHmQJBNv73mcZWNhDQOHs4wBoq+FG QWNqLU9xaZxdXw80r1viDAwOy13EUtcVbTkAEQEAAYkCPAQYAQgAJhYhBIWb6NfF hvU4QwsZwkZ7lC06eb0pBQJhuLq3AhsMBQkDwmcAAAoJEEZ7lC06eb0pSi8P/iy+ dNnxrtiENn9vkkA7AmZ8RsvPXYVeDCDSsL7UfhbS77r2L1qTa2aB3gAZUDIOXln5 1lSxMeeLtOequLMEV2Xi5km70rdtnja5SmWfc9fyExunXnsOhg6UG872At5CGEZU 0c2Nt/hlGtOR3xbt3O/Uwl+dErQPA4BUbW5K1T7OC6oPvtlKfF4bGZFloHgt2yE9 YSNWZsTPe6XJSapemHZLPOxJLnhs3VBirWE31QS0bRl5AzlO/fg7ia65vQGMOCOT LpgChTbcZHtozeFqva4IeEgE4xN+6r8WtgSYeGGDRmeMEVjPM9dzQObf+SvGd58u 2z9f2agPK1H32c69RLoA0mHRe7Wkv4izeJUc5tumUY0e8OjdenZZjT3hjLh6tM+m rp2oWnQIoed4LxUw1dhMOj0rYXv6laLGJ1FsW5eSke7ohBLcfBBTKnMCBohROHy2 E63Wggfsdn3UYzfqZ8cfbXetkXuLS/OM3MXbiNjg+ElYzjgWrkayu7yLakZx+mx6 sHPIJYm2hzkniMG29d5mGl7ZT9emP9b+CfqGUxoXJkjs0gnDl44bwGJ0dmIBu3aj VAaHODXyY/zdDMGjskfEYbNXCAY2FRZSE58tgTvPKD++Kd2KGplMU2EIFT7JYfKh HAB5DGMkx92HUMidsTSKHe+QnnnoFmu4gnmDU31i =Xqbo -----END PGP PUBLIC KEY BLOCK----- alocalhostpubkeyMySQL Release Engineering Public Keys(none)gpg(MySQL Release Engineering )gpg(3a79bd29)4.11.34:467b942d3a79bd29-61b8bab74:467b942d3a79bd29-61b8bab7?7e38a990026ad48f9ea0c034942888767a5d3d1dbqbqkage as well, if we have a special "embedded" subpackage - reworked the package descriptions- Added embedded server as a separate RPM- Added mysqld-max to the distribution- Added mysql-test to the bench package- Added separate libmysql_r directory; now both a threaded and non-threaded library is shipped.- Added the support-files/my-example.cnf to the docs directory. - Removed devel dependency on base since it is about client development.- Cleaned up some for 3.23.- Added support for shared libraries in a separate sub package. Original fix by David Fox (dsfox@cogsci.ucsd.edu) - The --enable-assembler switch is now automatically disables on platforms there assembler code is unavailable. This should allow building this RPM on non i386 systems.- Removed unportable cc switches from the spec file. The defaults can now be overridden with environment variables. This feature is used to compile the official RPM with optimal (but compiler version specific) switches. - Removed the repetitive description parts for the sub rpms. Maybe add again if RPM getxhXV`tI$dtIsIuI9749)- Rebuild for fixed documentation directory in redhat-rpm-macros- Update to a more recent 1.4.0 snapshot: - bond: fix defaults and be more liberal in accepting different formats of option values (rh #1352131) - bond: fix setting of "lp_interval" option (rh #1348573) - device: don't try to generate ipv6ll address for disconnected devices (rh #1351633) - device: make sure we update system hostname when DHCP configuration changes (rh #1356015) - device: tune down warning about failure to set userspace IPv6LL on non-existing device (rh #1323571) - nmcli: add "nmcli device modify" subcommand to do runtime configuration changes (rh #998000) - nmcli: crash on connection delete/down timeout (rh $1355740) - nmcli: fix 8021x settings tab-completion (rh #1301226) - secrets: increase timeout for getting the secrets from the agent (rh #1349740) - team: keep device config property up to date with actual configuration (rh #1310435) - team: make synchronization with teamd more robust (rh #1257237) - vpn: don't merge DNS properties into parent device's configuration (rh #1348901)- Do not regenerate gtk-doc. Together with parallel make it may cause multilib conflicts- enable JSON validation configure option - Update to a more recent 1.3.0 snapshot: - team: check return value of g_dbus_connection_call_sync() (rh #1347015)- Update to a 1.3.0 snapshot: - cli: hide secret certificate blobs unless --show-secrets set (rh #1184530) - dns: add support for specifying dns priorities (rh #1228707) - core: wait for IPv6 DAD before completing activation (rh #1243958) - device: take care of default route of DHCP generated-assumed connections (rh #1265239) - team: improve matching of team connection upon service restart (rh #1294728) - device: apply MTU setting also to devices without IPv4 configuration (rh #1303968) - device: reconfigure IP addressing after bringing up device (rh #1309899) - team: expose current device configuration through D-Bus and nmcli (rh #1310435) - systemd: add "After=dbus.service" to NetworkManager.service (rh #1311988) - cli: handle device failure when activating (rh #1312726) - core,libnm: remove gateway from connection if never-default is set (rh #1313091) - platform: remove padding for IP address lifetimes (rh #1318945) - manager: run dispatcher scripts on suspend/sleep (rh #1330694) - device: remove pending dhcp actions also in IP_DONE state (rh #1330893) - wwan: fixed multiple crashes (rh #1331395) - nmcli: fix tab completion for libreswan import (rh #1337300)- write /etc/resolv.conf as file by default instead of symlink (rh#1337222) - rename package config-routing-rules to dispatcher-routing-rules (rh #1334876)- Update to NetworkManager 1.2.0 release - vlan: keep the hardware address synchronized with parent device (rh #1325752) - bond: add more options (rh #1299103)- Update to a more recent 1.2.0 snapshot- Update to a 1.2.0 snapshot: - core: add a connection defaults section to NetworkManager.conf (rh #1164677) - dhcp: make timeout configurable (rh #1262922) - pppoe: set the firewall zone on the correct ip interface (rh #1110465) - device: properly roll back the device activation attempt on failure (rh #1270814) - nmcli: add monitor command (rh #1034158) - nmcli: fix shell completion of bluetooth device names (rh #1271271) - ipv4: add an option to send full FQDN in DHCP requests (rh #1255507) - core: fix a use-after-free() when activating a secondary VPN connection (rh #1277247) - wifi: fix bssid cache updating (rh #1094298) - vlan: honor the reorder-header flag (rh #1250225) - ipv4: do a duplicate address detection (rh #1259063) - core: add LLDP listener to the daemon and utilities (rh #1142898) - vpn: don't fail activation when plugin supports interactive mode, but the VPN daemon does not (rh #1298732) - ipv6: readd the address when the MAC address changes (rh #1286105) - core: avoid generating excessively long names for virtual devices (rh #1300755) - nmcli: add connection import and export (rh #1034105) - vlan: fix matching of connections on assumption (rh #1276343) - core: fixhXXVx |I$l|I{I}Iing modems - core: don't crash on PPPoE connections without a wired setting - core: ensure the AvailableConnections property is always correct - keyfile: ensure all-default VLAN connections are read correctly - core: suppress kernel's automatic creation of bond0 (rh #953466) - libnm-glib: make NMSecretAgent usable with GObject Introspection - libnm-util: fix GObject Introspection annotations of nm_connection_need_secrets() - core: documentation updates- Update to 0.9.8.2 snapshot - core: fix VLAN parent handling when identified by UUID - core: quiet warning about invalid interface index (rh #920145) - core: request 'static-routes' from DHCP servers (rh #922558) - core: fix crash when dbus-daemon is restarted (rh #918273) - core: copy leasefiles from /var/lib/dhclient to fix netboot (rh #916233) - core: memory leak and potential crash fixes - ifcfg-rh: ensure missing STP property is interpreted as off (rh #922702)- Update to the 0.9.8.0 release - cli: fix a possible crash- core: use systemd for suspend/resume, not upower- Update to 0.9.8-beta2 - core: ignore bridges managed by other tools (rh #905035) - core: fix libnl assert (rh #894653) - wifi: always use Proactive Key Caching with WPA Enterprise (rh #834444) - core: don't crash when Internet connection sharing fails to start (rh #883142)- Set correct systemd KillMode to fix anaconda shutdown hangs (rh #876218)- ifcfg-rh: write missing IPv6 setting as IPv6 with "auto" method (rh #830434)- Build vapi files and add them to the devel package- Apply patch from master to read hostname from /etc/hostname (rh #831735)- Apply patch from master to update hostname (rh #875085) - spec: create /etc/NetworkManager/dnsmasq.d (rh #873621)- Don't bring up uninitialized devices (fd #56929)- Actually apply the patch from the previous commit...- Apply patch from master to fix a crash (rh #865009)- Apply patch from master so connections finish connecting properly (bgo #685581)- Forward-port some forgotten fixes from F17 - Fix networked-filesystem systemd dependencies (rh #787314) - Don't restart NM on upgrade, don't stop NM on uninstall (rh #811200)- Update to git snapshot- Update to 0.9.7.0 snapshot- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Update to 0.9.6-rc2 - core: fix race between parallel DHCP client invocations - core: suppress a useless warning (rh #840580) - ifcfg-rh: fix segfault with malformed values (rh #841391) - ifcfg-rh: ignore IP config on bond slave configurations (rh #838907)- Update to 0.9.5.95 (0.9.6-rc1) snapshot - core: add autoconnect, driver-versioni and firmware-version properties to NMDevice - core: various IPv6 improvements - core: reduce number of changes made to DNS information during connection setup - core: add Vala language bindings - vpn: support IPv6 over VPNs - wifi: add on-demand WiFi scan support- Update to git snapshot- NM no longer uses /var/run/NetworkManager, so don't claim to own it. (rh #656638)- Update to git snapshot- Add _isa for internal requires; otherwise depsolving may pull in an arbitrary architecture.- Update to 0.9.4- libnm-glib: updated for new symbols the applet wants- applet: move to network-manager-applet RPM - editor: move to nm-connection-editor RPM - libnm-gtk: move to libnm-gtk RPM- Update to 0.9.3.997 (0.9.4-rc1) - core: fix possible WiFi hang when connecting to Ad-Hoc networks - core: enhanced IPv6 compatibility - core: proxy DNSSEC data when using the 'dnsmasq' caching nameserver plugin - core: allow VPNs to specify multiple domain names given by the server - core: fix an issue creating new InfiniBand connections - core/applet/editor: disable WiFi Ad-Hoc WPA connections until kernel bugs are fixed- core: fix issue with carrier changes not being recognized (rh #800690) - editor: warn user if CA certificate is left blank- core: fix a crash with ipw2200 devices and adhoc networks - core: fix IPv6 addressing on newer kernels - core: fix issue with VPN plugin passwords (rh #802540) - cli: enhancements for Bonding, VLAN, and OLPC mesh devices - ifcfxGXBU'$7'(& php72-php-pecl-libsodium- update to 7.2.0RC3- RC3 test build - F27: php now requires php-fpm and start it with httpd / nginx- update builder from RHEL 7.3 to RHEL 7.4- update to 7.2.0RC2- add patch for EL-6, fix undefined symbol: sqlite3_errstr- update to 7.2.0RC1- test build from git snapshot - refresh configuration files, sync with upstream, drop .so suffix- test build from git snapshot- test build from git snapshot - adapt tzdata patch for timelib 2017.05beta7 - disable httpd MPM check- update to 7.2.0beta3- add patch for EL-6, fix undefined symbol: sqlite3_errstr - revert use of sqlite3_close_v2 on EL-6- update to 7.2.0beta2 - oci8 version is now 2.1.7- update to 7.2.0beta1 - oci8 version is now 2.1.6 - bump apiver and zendver to 20170718- test build - add sodium extension in new sub-package- update to 7.2.0alpha3- update to 7.2.0alpha2 - oci8 version is now 2.1.5 - use oracle instant client version 12.2- update to 7.2.0alpha1- new snapshot - use system oniguruma (F26)- new snapshot- test build for release process test, 7.2.0alpha0 - dba: add --with-lmdb build option- new snapshot- new snapshot, May the 4th be with you - enable PHP execution of .phar files, see #1117140- refresh- update to 7.2.0-dev - drop mcrypt subpackage (removed upstream)- Update to 7.1.4 - http://www.php.net/releases/7_1_4.php- Update to 7.1.4RC1- Update to 7.1.3 - http://www.php.net/releases/7_1_3.php- fix interbase build on F26- Update to 7.1.3RC1- Update to 7.1.2 - http://www.php.net/releases/7_1_2.php- Update to 7.1.2RC1 (new sources)- Update to 7.1.2RC1- EL-7: add patch for https://bugs.php.net/73956 - switch back to gcc 6.2- EL-7: rebuild using gcc 4.8 instead of 6.2 because of https://bugzilla.redhat.com/1414348- Update to 7.1.1 - http://www.php.net/releases/7_1_1.php- Update to 7.1.1RC1- test optimized build using GCC 6.2- Update to 7.1.0 - http://www.php.net/releases/7_1_0.php - use bundled pcre library 8.38 on EL-7 - disable pcre.jit everywhere as it raise AVC #1398474 - sync provided configuration with upstream production defaults- Update to 7.1.0RC6- Update to 7.1.0RC5- Update to 7.1.0RC4 - update tzdata patch to v14, improve check for valid tz file - oci8 version is now 2.1.3- rebuild- Update to 7.1.0RC3- Update to 7.1.0RC2 - API version is now 20160303- Update to 7.1.0RC1 - oci8 version is now 2.1.2- Update to 7.1.0beta2- Update to 7.1.0beta1- Update to 7.1.0alpha3- own tests/doc directories for pecl packages (f24)- Update to 7.1.0alpha2 (rebuild)- Update to 7.1.0alpha2- Update to 7.1.0alpha1- Update to 7.0.7 - http://www.php.net/releases/7_0_7.php- Update to 7.0.7RC1 - oci8 version is now 2.1.1- Update to 7.0.6 - http://www.php.net/releases/7_0_6.php - rebuild for new sources- Update to 7.0.6 http://www.php.net/releases/7_0_6.php- Update to 7.0.6RC1- Fixed bug #71914 (Reference is lost in "switch")- Update to 7.0.5 http://www.php.net/releases/7_0_5.php- Update to 7.0.5RC1- adapt for F24: define %pecl_xmldir and own it- Update to 7.0.4 http://www.php.net/releases/7_0_4.php - pcre: disables JIT compilation of patterns with system pcre < 8.38- Update to 7.0.4RC1- Update to 7.0.3 http://www.php.net/releases/7_0_3.php- test build- FPM: test build for https://bugs.php.net/62172- Update to 7.0.3RC1- Update to 7.0.2 http://www.php.net/releases/7_0_2.php- Update to 7.0.2RC1 - opcache: build with --disable-huge-code-pages on EL-6- Update to 7.0.1 http://www.php.net/releases/7_0_1.php - curl: add CURL_SSLVERSION_TLSv1_x constant (EL) - fpm: switch to UDS on Fedora >= 21- Update to 7.0.1RC1 - drop --disable-huge-code-pages build option on EL-6, but keep it disabled in default configuration- build with --disable-huge-code-pages on EL-6- Update to 7.0.0 http://www.php.net/releases/7_0_0.php- set opcache.huge_code_pages=0 on EL-6 see https://bugs.php.net/70973 and https://bugs.php.net/70977- Update to 7.0.0RC8 - set opcache.huge_code_pages=1 on x86_64- Update to 7.0.0RC7 (retagged)- Update to 7.0.0RC7- Update to 7.0.0RC6xH7XW@j1?c$/?c>c@coject.org> 5.5.34-1Remi Collet 5.5.33-2Remi Collet 5.5.33-1Remi Collet 5.5.32-1Remi Collet 5.5.31-1Remi Collet 5.5.30-1Remi Collet 5.5.29-1Remi Collet 5.5.28-1Remi Collet 5.5.27-1Remi Collet 5.5.27-0.1.RC1Remi Collet 5.5.26-1Remi Collet 5.5.26-0.1.RC1Remi Collet 5.5.25-1Remi Collet 5.5.25-0.1.RC1Remi Collet 5.5.24-2Remi Collet 5.5.24-1Remi Collet 5.5.24-0.1.RC1Remi Collet 5.5.23-1Remi Collet 5.5.23-0.1.RC1Remi Collet 5.5.22-1Remi Collet 5.5.21-1Remi Collet 5.5.21-0.2.RC1Remi Collet 5.5.21-0.1.RC1Remi Collet 5.5.20-2Remi Collet 5.5.20-1Remi Collet 5.5.20-0.1.RC1Remi Collet 5.5.19-2Remi Collet 5.5.19-1Remi Collet 5.5.19-0.1.RC1Remi Collet 5.5.18-1Remi Collet 5.5.17-2Remi Collet 5.5.17-1Remi Collet - 5.5.16-1Remi Collet - 5.5.6-10Remi Collet - 5.5.6-9Remi Collet - 5.5.6-8Remi Collet - 5.5.6-7Remi Collet - 5.5.6-6Remi Collet - 5.5.6-5Remi Collet - 5.5.6-4Remi Collet 5.5.6-2Remi Collet 5.5.6-0Remi Collet 5.5.5-1Remi Collet 5.5.4-1Remi Collet 5.5.3-1Remi Collet 5.5.1-1Remi Collet 5.4.16-6Remi Collet 5.4.16-5Remi Collet 5.4.16-4Remi Collet - 5.4.16-3Remi Collet 5.4.16-2Remi Collet 5.4.16-1Remi Collet 5.4.14-3Remi Collet 5.4.14-2Remi Collet 5.4.14-1Remi Collet 5.4.13-1Remi Collet 5.4.11-1Remi Collet 5.4.10-1Remi Collet 5.4.9-1Remi Collet 5.4.8-7Remi Collet 5.4.8-6Remi Collet 5.4.8-5Remi Collet 5.4.8-6Remi Collet 5.4.8-4Remi Collet 5.4.8-4Remi Collet 5.4.8-3Joe Orton - 5.4.8-2Remi Collet 5.4.8-3Remi Collet 5.4.8-2.1Remi Collet 5.4.8-2Remi Collet 5.4.8-1.2Remi Collet 5.4.8-1Remi Collet 5.4.7-4Remi Collet 5.4.7-3Remi Collet 5.4.7-2Remi Collet 5.4.7-1Remi Collet 5.4.7-10Remi Collet 5.4.7-9Remi Collet 5.4.7-8Remi Collet 5.4.7-7Remi Collet 5.4.7-6Remi Collet 5.4.7-5Remi Collet 5.4.7-4Remi Collet 5.4.7-3Remi Collet 5.4.7-2Remi Collet 5.4.7-1Remi Collet 5.4.6-2Remi Collet 5.4.6-1Remi Collet 5.4.5-1Remi Collet 5.4.4-4Remi Collet 5.4.4-3Remi Collet 5.4.4-2Remi Collet 5x&XVJ}I$m}I|I~Ig-rh: fix quoting WPA passphrases that include quotes (rh #798102) - libnm-glib: fix some issues with duplicate devices shown in menus- Update to 0.9.3.995 (0.9.4-beta1) - core: add support for bonding and VLAN interfaces - core: add support for Internet connectivity detection - core: add support for IPv6 Privacy Extensions - core: fix interaction with firewalld restarts- disable WiMAX plugin on s390(x)- Put WiMAX plugin files in the right subpackage- Update to 0.9.4 snapshot - wimax: enable optional support for Intel WiMAX devices - core: use nl80211 for WiFi device control - core: add basic support for Infiniband IP interfaces - core: add basic support for bonded interfaces - core: in-process IP configuration no longer blocks connected state- Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Rebuild for libgnome-bluetooth.so.9- core: fix possible crash when talking to ModemManager - core: improve handling of rfkill on some machines (eeepc 1005HA and others) - ifcfg-rh: don't use spaces in ifcfg file names (rh #742273) - core: accept IPv6 Router Advertisements when forwarding is on - core: bump dnsmasq cache size to 400 entries - core: ensure IPv6 static routes are flushed when device is deactivated - ifcfg-rh: fix changing WPA connections to WEP - core: fix setting hostname from DHCP (rh #719100) - libnm-glib: fix various GObject introspection issues (rh #747302) - core: don't change routing or DNS if no devices are managed - core: ensure IPv6 RA-provided routes are honored- Rebuilt for glibc (rh #747377) - core: fix setting hostname from DHCP options (rh #719100) - skip a release to keep up with F16- core: fix location of wifi.ui (rh #741448)- core: ifcfg-rh: remove newlines when writing to ifcfg files (CVE-2011-3364) (rh #737338) - core: change iscsiadm path to /sbin/iscsiadm in ifcfg-rh plugin (rh #740753) - core: fix refcounting when deleting a default wired connection (lp:797868)- Update to 0.9.1.90 (0.9.2-beta1) - core: fix IPv6 link-local DNS servers in the dnsmasq DNS plugin - cli: add ability to delete connections - keyfile: fix an issue with duplicated keyfile connections - core: ensure the 'novj' option is passed through to pppd - core: store timestamps for VPN connections too (rh #725353)- fix systemd scriptlets and trigger- Update to 0.9 release - core: fix issue where scan results could be ignored - core: ensure agent secrets are preserved when updating connections - core: don't autoconnect disabled modems - core: fix race when checking modem enabled/disabled status after disabling - core: ensure newly installed VPN plugins can actually talk to NM - core: add support for 802.1X certificate subject matching - libnm-glib: various introspection fixes - applet/editor: updated translations- Add some patches for some blocker (rh #727501)- core: updated Russian translation (rh #652904) - core: fix possible crash if secrets are missing - core: append interface name for IPv6 link-local DNS server addresses (rh #720001) - core: fix setting hostname from DHCP options (rh #719100) - libnm-util: GObject introspection annotation fixes - libnm-util: ensure IP address/route prefixes are valid - ifcfg-rh: read anonymous identity for 802.1x PEAP connections (rh #708436) - applet: show notifications on CDMA home/roaming changes - applet: fix various issues saving VPN secrets - editor: allow exporting VPN secrets - editor: default to IPv6 "automatic" addressing mode- core: ensure users are authorized for shared wifi connections (CVE-2011-2176) (rh #715492) - core: retry failed connections after 5 minute timeout - core: immediately request new 802.1x 'always ask' passwords if they fail - core: add MAC blacklisting capability for WiFi and Wired connections - core: retry failed connections when new users log in (rh #706204) - applet: updated translations - core: drop compat interface now that KDE bits are updated to NM 0.9 API- core: don't cache "(none)" hostname at startup (rh #706094) - core: fix handling of VPN connections with only system-owned secrets - x(XW'v$1vv_parse.hyajl_tree.hyajl_version.hlibyajl.soyajl.pcyajl-devel-2.0.4COPYING/usr/include//usr/include/yajl//usr/lib64//usr/lib64/pkgconfig//usr/share/doc//usr/share/doc/yajl-devel-2.0.4/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnudirectoryC source, ASCII textpkgconfig fileASCII textRPR?0xSA!$ƨw-pPd4YVd YM)!jD:uQ]^lj 6^5CA!2\J^P 5?j-ޠZd@"J'{NN[ؠHBy5m*ZlH+c;OvzJS:rqφJ3PTDg~N{NEU l /-xEޗ5eLcԭ%y%c8+II{t@ Xz#5.| +Mir#i>,`u}[h/JTP t}mt3W|oZQr6K?:toA*`O,RjƲH`tk/ˆȈ ۼ(?QiJ2q?(]O>G-8J52LɳfnNkNߟp?x%kѯAf?rVb jUզFy/zJYE7%_<5geAps?H"mɈJ^Tʱv>Teyu.i8u:P+οx/yd.ZIs>0x Jp *$74Rj&Ndi-4S1 n[aw빔@x VA.W-O3'w6Lؽ>ɆpkycXt^b;XGl|;zJc̿$E\_y!* q7ngO| eۥٓqk7KUw6rE3{~J $2KW0_8RۉZ_5$ƨǬß88ͧid6=np5 hZ˒%IC_¡C<T /f^Մ 9w2~-/]GRW !@lFT(u ջ%YMISptM(< H_Jp_P)"y("oLQ$u]/PϹcTQ9=ue,ї67U撑||[y`.oH#;' #O&Ġn1ƣW$-ϲEB/ldzk"giG?3mb5Mx m]-Qa쪍Pj {Tk/izGCCxZ,хz,լ`銭 O6/!W4]oL%x!EylL )HJTU?JkbSUukBv[O\ch  ߵ'nL+3087fffb972005b1ccbbbc725ce5086628566c7bbenb1d_cnt_all function in other places (Stefan Assmann) [1091126] - [ethernet] i40e: Report cmd->data in ETHTOOL_GRXCLSRLCNT instead of ETHTOOL_GRXCLSRULE (Stefan Assmann) [1091126] - [ethernet] i40e/i40evf: Remove reserved PCTYPE defines (Stefan Assmann) [1091126] - [ethernet] i40e: Tx/Rx rings declaration (Stefan Assmann) [1091126] - [ethernet]aselinux-policy.conf-i/6 server.conf in setfiles.8.gzr sestatus.8.gzr semodule.8.gzssestatus.conf.5.gztheiselinux_config.5.gzr s secon.1.gzann setfiles] vsestatustnsemoduleA9seconi sestatus.confr service.8.gzptnservice[1C session.da session.confrAserial-getty@.service:selinux-loadpolicy.shKm setarch.8.gz-9osetarche  session_button.pngfan1session_button-li.pngaselfservt<ssess_id.1ssl.gzefO serbian- aesepermit $rsepermit.conf.5.gzAsse sepermit.conf!rsecuritytvgselectmodule.somas 6services.appende:r?eseq.1.gzS setjmp.modX setfacl.1.gzXsetfaclc3setenforce.8.gzc setenforce& setcap.8.gz&setcap^-set.1.gzGservicesc"service_seusers.5.gzt serial.modrrEseqc!sepgsql_contexts.5.gz sendkey.mod)nsemanage.conf.5.gzn semanage.conf{--semvec2selinuxexeccon.8.gzc selinuxexecconc1selinuxenabled.8.gzc selinuxenabledc0selinuxdefcon.8.gzc selinuxdefconc/selinuxconlist.8.gzc selinuxconlistcselinux_restoreconc. selinux.8.gz0nnselinuxc selabel_x.5.gzcselabel_partial_matchcselabel_media.5.gzcselabel_lookup_best_matchcselabel_lookupcselabel_file.5.gzcselabel_digestcselabel_db.5.gzd- selusc-sefcontext_compile.8.gz sefcontext_compileH s sedfaq.txt.gz0    !"#$%&'()*+,-./0esed.mo s sed.info.gz1sed.1.gzs sed-4.2.2sedpcsecuretty_types.5.gz securettycsecolor.conf.5.gzxxXuW"${ 3.1.0-13Nalin Dahyabhai - 3.1.0-12Nalin Dahyabhai - 3.1.0-11Fedora Release Engineering - 3.1.0-10Nalin Dahyabhai - 3.1.0-9Nalin Dahyabhai - 3.1.0-8Nalin Dahyabhai - 3.1.0-7Nalin Dahyabhai - 3.1.0-6Nalin Dahyabhai - 3.1.0-5Jeremy Katz - 3.1.0-4Nalin Dahyabhai - 3.1.0-3Nalin Dahyabhai - 3.1.0-2Nalin Dahyabhai - 3.1.0-1Jesse Keating - 3.0.2-31.2.1Jesse Keating - 3.0.2-31.2Jesse Keating Nalin Dahyabhai 3.0.2-31Elliot Lee Elliot Lee Elliot Lee Florian La Roche Nalin Dahyabhai 3.0.2-28Elliot Lee Nalin Dahyabhai 3.0.2-26Tim Powers 3.0.2-25Phil Knirsch 3.0.2-24Phil Knirsch 3.0.2-23Nalin Dahyabhai 3.0.2-22Nalin Dahyabhai Tim Powers Tim Powers Nalin Dahyabhai 3.0.2-19Nalin Dahyabhai 3.0.2-18Nalin Dahyabhai 3.0.2-17Tim Powers Nalin Dahyabhai 3.0.2-15Nalin Dahyabhai 3.0.2-14Nalin Dahyabhai Nalin Dahyabhai Jeremy Katz Jeremy Katz Jeremy Katz Jeremy Katz Jeremy Katz Nalin Dahyabhai Nalin Dahyabhai - Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- update to 3.2.1 - merged all patches or equivalents - re-merged hesinfo, so we obsolete it now - adds a pkgconfig configuration file for libhesiod - correct inconsistent changelog dates, assuming day-of-week is correct - add build requirement on libidn-devel - package the license- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- fix the release number noted for the previous changelog entry (#225884) - remove unapplied "classes" patch (#225884)- adjust buildroot location (guidelines) - disable static libraries (guidelines) - tweak default payload attributes (guidelines)- add a disttag- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- adjust the package summary- rebuild- call aclocal directly, because autoreconf didn't see the magic comment in the distributed version of aclocal.m4 which made it look like it was safe to generate a new one (#449550)- force autoreconf to overwrite files (should fix #449550)- Autorebuild for GCC 4.3- rebuild- rebuild- use the system libtool to consistently link libhesiod.la with libresolv- run autoreconf instead of autoconf after untarring so that we get a config.h.in which suits the changes we make to configure.in (part of #197938)- don't override libtool's defaults for permissions on its .la file, because we don't get debuginfo if the execute bit isn't set (pjones, in #190219)- rebuild for -devel deps- no, we really did need that patch- drop a no-longer-needed patch for detecting libresolv properly- update to 3.1.0 (#187372)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- rebuild- rebuilt- rebuilt- rebuilt- add a %clean specfile target- rebuild- rebuilt- link libhesiod with libresolv on all platforms- rebuilt- Fixed wrong .so name for s390/s390x.- Build shared lib correctly on s390 and s3xX WPǃ$Wǃȃƃ0150428git94f0b94Remi Collet 7.0.0-0.5.20150427git1a4d3e4Remi Collet 7.0.0-0.5.20150418git1f0a624Remi Collet 7.0.0-0.5.20150416gitc77d97fRemi Collet 7.0.0-0.5.20150403gitadcf0c6Remi Collet 7.0.0-0.4.20150331git463ca30Remi Collet 7.0.0-0.3.20150325git2fe6acdRemi Collet 7.0.0-0.2.20150325git23336d7Remi Collet 7.0.0-0.1.20150325git23336d7Remi Collet 5.6.7-1Remi Collet 5.6.7-0.1.RC1Remi Collet 5.6.6-1Remi Collet 5.6.5-1Remi Collet 5.6.5-0.2.RC1Remi Collet 5.6.5-0.1.RC1Remi Collet 5.6.4-2Remi Collet 5.6.4-1Remi Collet 5.6.4-0.1.RC1Remi Collet 5.6.3-3Remi Collet 5.6.3-2Remi Collet 5.6.3-1Remi Collet 5.6.3-0.1.RC1Remi Collet 5.6.2-1Remi Collet 5.6.1-1Remi Collet 5.6.0-1.1Remi Collet 5.6.0-1Remi Collet - 5.6.0-0.1.RC4Remi Collet - 5.5.6-10Remi Collet - 5.5.6-9Remi Collet - 5.5.6-8Remi Collet - 5.5.6-7Remi Collet - 5.5.6-6Remi Collet - 5.5.6-5Remi Collet - 5.5.6-4Remi Collet 5.5.6-2Remi Collet 5.5.6-0Remi Collet 5.5.5-1Remi Collet 5.5.4-1Remi Collet 5.5.3-1Remi Collet 5.5.1-1Remi Collet 5.4.16-6Remi Collet 5.4.16-5Remi Collet 5.4.16-4Remi Collet - 5.4.16-3Remi Collet 5.4.16-2Remi Collet 5.4.16-1Remi Collet 5.4.14-3Remi Collet 5.4.14-2Remi Collet 5.4.14-1Remi Collet 5.4.13-1Remi Collet 5.4.11-1Remi Collet 5.4.10-1Remi Collet 5.4.9-1Remi Collet 5.4.8-7Remi Collet 5.4.8-6Remi Collet 5.4.8-5Remi Collet 5.4.8-6Remi Collet 5.4.8-4Remi Collet 5.4.8-4Remi Collet 5.4.8-3Joe Orton - 5.4.8-2Remi Collet 5.4.8-3Remi Collet 5.4.8-2.1Remi Collet 5.4.8-2Remi Collet 5.4.8-1.2Remi Collet 5.4.8-1Remi Collet 5.4.7-4Remi Collet 5.4.7-3Remi Collet 5.4.7-2Remi Collet 5.4.7-1Remi Collet 5.4.7-10Remi Collet 5.4.7-9Remi Collet 5.4.7-8Remi Collet 5.4.7-7Remi Collet 5.4.7-6Remi Collet 5.4.7-5Remi Collet 5.4.7-4Remi Collet 5.4.7-3Remi Collet 5.4.7-2Remi Collet 5.4.7-1Remi Collet 5.4.6-2Remi Collet 5.4.6-1Remi Collet 5.4.5-1Remi Collet 5.4.4-4Remi Collet 5.4.4-3Remi Collet 5.4.4-2Remi Collet 5.4.4-1Remi Collet 5.4.3-1Remi Collet 5.4.2-1Remi Collet 5.4.1-1Joe Orton xhX  W $noblems with the cumulative patch issued by the png developers. - Build for FC1- rebuilt- Rebuild for FC2- Rebuild for FC1- Reinstate and improve the transfix patch which got lost sometime ago, but is still needed for CAN-2002-1363 (#125934)- add patch to link libm automatically - get rid of rpath- 1.2.5- Redo the out-of-bounds fix in a slightly better way.- Bump release number to disambiguate n-v-rs.- fix a possible out-of-bounds read in the error message handler. #121229- rebuilt- rebuild with changed bits/setjmp.h on ppc- rebuilt- rebuilt- add explicit epoch's where needed.- change pkg-config to use libdir instead of hardcoding /usr/lib- rebuilt- add Provides: libpng.so.3, #67007- change requires to include the Epoch- Bump & rebuild- rebuilt- Bump & rebuild- merge changes in from -6hammer- automated rebuild- automated rebuild- Don't own {_libdir}/pkgconfig - Don't strip library, that's up to rpm- Forgot png.h- Fix compatibility with everyone else.- 1.2.2 plus makefile patches tarball - update file list to contain versioned libpng only- automated rebuild- 1.2.1- 1.2.0- s/Copyright/License/ - fix weird versioning system (epoch was set to "2" in the main package, serial to "1" in the devel package. Huh?)- update to 1.0.12 - add missing libpng symlink- libpng-devel requires zlib-devel (since png.h includes zlib.h) (#38883)- 1.0.11- 1.0.10- 1.0.9, fixes Mozilla problems- Rebuild to get rid of 0777 dirs- Remove the workaround for Bug #20018 (from Oct 30). Qt 2.2.2 fixes the problem the workaround addressed.- Work around a problem causing konqueror to segfault in image preview mode (Bug #20018) - Copy SuSE 7.0's patch to handle bad chunks- only include the man5 man-pages once in the main rpm- upgrade to 1.0.8 - fixes small memory leak, other bugs- automatic rebuild- patchlevel c - FHSify- update to 1.0.6- change serial to Epoch to get dependencies working correctly- move buildroot and add URL- strip library - rebuild to compress man pages- 1.0.5 - some tweaks to spec file to make updating easier - handle RPM_OPT_FLAGS- changed requires in libpng-devel to include serial - corrected typo- auto rebuild in the new build environment (release 2)- rev to 1.0.3- build for 6.0- we are Serial: 1 now because we are reverting the 1.0.2 version from 5.2 beta to this prior one - install man pages; set defattr defaults- translations modified for de, fr, tr- devel subpackage moved to Development/Libraries- upgraded to 1.0.1 - added buildroot- updated to new version - spec file cleanups- built against glibc 2:1.5.13-8.el72:1.5.13-8.el71.5.131.5.13libpng-configlibpng15-configlibpng15png.hpngconf.hpnglibconf.hpng.hpngconf.hpnglibconf.hlibpng.solibpng15.solibpng.pclibpng15.pclibpng.3.gzlibpngpf.3.gz/usr/bin//usr/include//usr/include/libpng15//usr/lib64//usr/lib64/pkgconfig//usr/share/man/man3/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuPOSIX shell script, ASCII text executabledirectoryASCII textpkgconfig filetroff or preprocessor input, ASCII text, with very long lines (gzip compressed data, from Unix, max compression)troff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)RRPRPR?p؉_I2$ƨQrKW`[!$ <ڢ4 XE)@q [$dCliWRj_Ԡ9^;59AzB$2/Me!\$r%h#X_iReȉ:-uV X @KU//YxX WX@}$~-common) - build gmp extension shared (in php-bcmath) - build shmop extension shared (in php-process)- drop some old compatibility provides (php-api, php-zend-abi, php-pecl-*) - obsoletes php55-*- update to have zend_execute_ex for xDebug- Initial work on 5.5.0-dev- add patch for https://bugs.php.net/63588 duplicated implementation of php_next_utf8_char- update to 5.4.9- switch back to upstream generated scanner/parser- use _httpd_contentdir macro and fix php.gif path- improve system libzip patch to use pkg-config- use _httpd_moddir macro- update to 5.4.9RC1 - improves php.conf (use FilesMatch + SetHandler) - improves filter (httpd module) - apply ldap_r patch on fedora >= 18 only- sync with rawhide- clarify Licenses - missing provides xmlreader and xmlwriter - modernize spec- update to 5.4.9RC1 - change php embedded library soname version to 5.4- fix _httpd_mmn macro definition- fix mysql_sock macro definition- fix installed headers- use libldap_r for ldap extension- update to 5.4.8 - define both session.save_handler and session.save_path - fix possible segfault in libxml (#828526) - php-fpm: create apache user if needed - use SKIP_ONLINE_TEST during make test - php-devel requires pcre-devel and php-cli (instead of php)- provides php-phar- update systzdata patch to v10, timezone are case insensitive- update to 5.4.8RC1- fix typo in systemd macro- php-fpm: enable PrivateTmp - php-fpm: new systemd macros (#850268) - php-fpm: add upstream patch for startup issue (#846858)- systemd integration, https://bugs.php.net/63085 - no odbc call during timeout, https://bugs.php.net/63171 - check sqlite3_column_table_name, https://bugs.php.net/63149- most failed tests explained (i386, x86_64)- fix for http://bugs.php.net/63126 (#783967)- add --daemonize / --nodaemonize options to php-fpm upstream RFE: https://bugs.php.net/63085- sync with rawhide - patch to report libdb version https://bugs.php.net/63117- patch to ensure we use latest libdb (not libdb4)- really fix rhel tests (use libzip and libdb)- fix test to enable zip extension on RHEL-7- remove session.save_path from php.ini move it to apache and php-fpm configuration files- update to 5.4.7 http://www.php.net/releases/5_4_7.php - php-fpm: don't daemonize- update to 5.4.7- obsoletes php53* and php54*- update to 5.4.7RC1- enable php-fpm on secondary arch (#849490)- update to 5.4.6- update to 5.4.6RC1- update to 5.4.5- update patch for system libzip- update to 5.4.5RC1 with bundled libzip.- use system pcre only on fedora >= 14 (version 8.10) - drop BR for libevent (#835671) - provide php(language) to allow version check - define %{php_version}- clean spec, sync with rawhide - add missing provides (core, ereg, filter, standard)- update to 5.4.4 finale - fedora >= 15: use /usr/lib/tmpfiles.d instead of /etc/tmpfiles.d - fedora >= 15: use /run/php-fpm instead of /var/run/php-fpm- update to 5.4.4RC2- update to 5.4.4RC1- update to 5.4.3 (CVE-2012-2311, CVE-2012-2329)- update to 5.4.2 (CVE-2012-1823)- update to 5.4.1 - use libdb in fedora >= 18 instead of db4- update to 5.4.1RC2- rebuild- update to 5.4.1RC1, split php conf when httpd 2.4- sync with rawhide (httpd 2.4 stuff)- rebuild against httpd 2.4 - use _httpd_mmn, _httpd_apxs macros - fix --without-system-tzdata build for Debian et al- update to PHP 5.4.0 finale- update to 5.4.0RC8- update to 5.4.0RC7- build against system libzip (fedora >= 17), patch from spot- add /etc/sysconfig/php-fpm environment file (#784770)- keep all ZTS binaries in /usr/bin (with zts prefix)- update to 5.4.0RC6- add some fedora patches back (dlopen, easter, phpize)- improves mysql.sock default path- update to 5.4.0RC5 - patch for https://bugs.php.net/60748 (mysql.sock hardcoded) - move session.path from php.ini to httpd/conf.d/php.conf - provides both ZTS mysql extensions (libmysql/mysqlnd) - build php cli ZTS binary, in -devel, mainly for test- new snapshot (5.4.0RC5-dev) with fix for https://bugs.php.net/60627- new snapshot (5.4.0RC5-dev)- new snapshot (5.4xXX ^W}$m}~|.6-4Joe Orton 5.1.6-3Joe Orton 5.1.6-2Jesse Keating - 5.1.4-8.1Joe Orton 5.1.4-8Joe Orton 5.1.4-7Joe Orton 5.1.4-6Radek Vokal 5.1.4-5.1Joe Orton 5.1.4-5Joe Orton 5.1.4-3Joe Orton 5.1.3-3Joe Orton 5.1.2-5Jesse Keating - 5.1.2-4.3Jesse Keating - 5.1.2-4.1Joe Orton 5.1.2-4Joe Orton 5.1.2-3Joe Orton 5.1.2-2Joe Orton 5.1.1-8Joe Orton 5.1.1-7Joe Orton 5.1.1-6Jesse Keating Joe Orton 5.1.1-5Joe Orton 5.1.1-4Joe Orton 5.1.1-3Joe Orton 5.1.1-2Tomas Mraz 5.0.5-6Joe Orton 5.0.5-5Joe Orton 5.0.5-4Joe Orton 5.0.5-3Joe Orton 5.0.4-11Joe Orton 5.0.4-10Joe Orton 5.0.4-9Joe Orton 5.0.4-8Joe Orton 5.0.4-7Joe Orton 5.0.4-6Joe Orton 5.0.4-5Joe Orton 5.0.4-4Joe Orton 5.0.4-3Joe Orton 5.0.4-2Joe Orton 5.0.4-1Joe Orton 5.0.3-5Joe Orton 5.0.3-4Joe Orton 5.0.3-3Joe Orton 5.0.3-2Joe Orton 5.0.3-1Joe Orton 5.0.2-8Joe Orton 5.0.2-7Joe Orton 5.0.2-6Joe Orton 5.0.2-5Joe Orton 5.0.2-4Joe Orton 5.0.1-4Joe Orton 5.0.1-3Joe Orton 5.0.1-2Joe Orton 5.0.1-1Tom Callaway Tom Callaway - Fix filter bypass in filter_var FILTER_VALIDATE_URL CVE-2024-5458- use oracle client library version 21.13 - Fix __Host-/__Secure- cookie bypass due to partial CVE-2022-31629 fix CVE-2024-2756 - Fix password_verify can erroneously return true opening ATO risk CVE-2024-3096- Fix Security issue with external entity loading in XML without enabling it GHSA-3qrf-m4j2-pcrr CVE-2023-3823 - Fix Buffer mismanagement in phar_dir_read() GHSA-jqcx-ccgc-xwhv CVE-2023-3824 - move httpd/nginx wants directive to config files in /etc- fix possible buffer overflow in date - define %php71___phpize and %php71___phpconfig- Fix Missing error check and insufficient random bytes in HTTP Digest authentication for SOAP GHSA-76gg-c692-v2mw CVE-2023-3247 - use oracle client library version 21.10- fix #81744: Password_verify() always return true with some hash CVE-2023-0567 - fix #81746: 1-byte array overrun in common path resolve code CVE-2023-0568 - fix DOS vulnerability when parsing multipart request body CVE-2023-0662- pdo: fix #81740: PDO::quote() may return unquoted string CVE-2022-31631 - use oracle client library version 21.8- phar: fix #81726 DOS when using quine gzip file. CVE-2022-31628 - core: fix #81727 Don't mangle HTTP variable names that clash with ones that have a specific semantic meaning. CVE-2022-31629 - use oracle client library version 21.7- use oracle client library version 21.6 - mysqlnd: fix #81719: mysqlnd/pdo password buffer overflow. CVE-2022-31626 - pgsql: fix #81720: Uninitialized array in pg_query_params(). CVE-2022-31625- Fix #79971 special character is breaking the path in xml function CVE-2021-21707- fix PHP-FPM oob R/W in root process leading to priv escalation CVE-2021-21703 - use libicu version 69 - use oracle client library version 21.3- fix intl build on F35- Fix #81211 Symlinks are followed when creating PHAR archive- Fix #81122 SSRF bypass in FILTER_VALIDATE_xТX &X ^$C^^ dora_21_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Pull in the latest version.- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Rebuilt for c++ ABI breakage- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- use INSTALL="install -p", fix license tag, fix Source0 url according guidelines- Initial Release0.7.4-4.el70.7.4-4.el7nloadnload-0.7.4AUTHORSCOPYINGChangeLogNEWSREADMEnload.1.gz/usr/bin//usr/share/doc//usr/share/doc/nload-0.7.4//usr/share/man/man1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=0xccc9b3b5cbb225ce2d7436129f59c45c69352f89, strippeddirectoryASCII textPascal source, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)RRRRR R RR R RRRR RRRR?pT&j/5,dYW>L9+)hX+bLzD|e$@;'![]ʏQ .`ϖ !(}lF9 JeK`ǏdFŏzlVsu ͨ0nۖ6ѳBo!h #,|PQ+ \GU-ĭ q_oAٺ%~Y$ڷ\Gר-3ΰ^vntb@)T= k(jŷ˫_+U R~MqfKN ĈX$m'vوVB)z8e?g!Eרέc"y>`8)l@T1@0^OzOH}L "a27uN>D'=k5nO]|dˆpm1vvB9(ݐGOa525;W8vqj9O)n=CҜNzp#YK][fQ4u?>T&j/5,dp|nJZMy3)5nl.Xi}$JKiib$A+MD,n[tGCԺ(sCJ(4],/$zV5l^NԌ gPB<<̗}ϸa<> b=~0&j!.L-1Ҥb31dbb60f06bc39a8ebeba8e8aee01ccd12f9137eC]C<eC]Bto 1.15.3 (stable)- update to 1.15.2 (stable)- add upstream patch for libzip 1.3.1- F27: release bump- rebuild for PHP 7.2.0beta1 new API- update to 1.15.1 (stable)- update to 1.15.0 (stable)- rebuild for 7.2.0alpha2- update to 1.14.0 (stable) - always buid with system libzip (bundled lib dropped upstream)- refresh with pasword support in stream wrapper- update to 1.4.0-dev with encryption support - raise dependency on libzip 1.2.0- rebuild with PHP 7.1.0 GA- Update to 1.13.5- rebuild for PHP 7.1 new API version- Update to 1.13.4- Update to 1.13.3- Update to 1.13.2 - fix license management- rebuild for PHP 7.0.0RC5 new API version- F23 rebuild with rh_layout- Update to 1.13.1- Update to 1.13.0 - raise dependency on libzip 1.0.0- Update to 1.12.5 - Don't install/register tests- new scriptlets- allow SCL build- add numerical prefix to extension configuration file- Update to 1.12.4 (stable) for libzip 0.11.2- Update to 1.12.3 (stable) - drop merged patch- upstream patch, don't use any libzip private struct - drop LICENSE_libzip when system version is used - always build ZTS extension- update to 1.12.2 (beta) - drop merged patches - install doc in pecl doc_dir - install tests in pecl test_dir- backport stuffxHXVW g$wghfb6ba0a844eacd33828c376a15ffedb7ea19b15195f9c90b0ecd9fe8c8a52fcee953ea31ee0fe653b31bafc48f36673aea43f57c176e40bda8ae67b97452b7c03718067dd76dc09d14a7215712d77dcd251307e59142a82b61d7e937195fd8b54032027f1998e0791060714f3c5607809ce06a87df4b0ee97e1a9777b585dd5e6a9f68b59a27dba3d27ebd4b78d7786993311cd6367ede08813b1b5635e2b4753659fe83f0796c1778bf33946582c4c8d999892f9ce16693bd68618341f566f798ee27e7f6f7655b325c71421a2510b3927f7c1ca0d49fa19265ba843d4f7649dbb6d1f8517efe54100da4dbad24a0756e2092e6dcc1a3825d3fa6f0edd42852d68c14ccf20c85ed3720f01f2d2bac467632bf886a59d5659f2366b6d4459125d8bd797ebd6f2e9532b38516a91545c213940148ee0ac3e23654c2db3d03551105696141a7dc73990b3545d7026d14014d2ccab220828belibrpm.so.3.2.2librpmbuild.so.3.2.2librpmio.so.3.2.2librpmsign.so.1.2.2rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrpm-4.11.3-48.el7_9.src.rpmpkgconfig(rpm)rpm-develrpm-devel(x86-64)@@@@@@@@@@@@@@@@@@@@@@@@@   @ /usr/bin/pkg-configlibacl.so.1()(64bit)libaudit.so.1()(64bit)libbz2.so.1()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libcap.so.2()(64bit)libdb-5.3.so()(64bit)libdl.so.2()(64bit)libelf.so.1()(64bit)liblua-5.1.so()(64bit)liblzma.so.5()(64bit)libm.so.6()(64bit)libnss3.so()(64bit)libpopt.so.0()(64bit)libpopt.so.0(LIBPOPT_0)(64bit)libpthread.so.0()(64bit)librpm.so.3()(64bit)librpmbuild.so.3()(64bit)librpmio.so.3()(64bit)librpmsign.so.1()(64bit)libselinux.so.1()(64bit)libz.so.1()(64bit)popt-devel(x86-64)rpmrpm-build-libs(x86-64)rpm-libs(x86-64)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)4.11.3-48.el7_94.11.3-48.el7_94.11.3-48.el7_93.0.4-14.6.0-14.0-15.2-14.11.3aaqV@aD@^?@^V@]4@]]2@]V\\|\|\+@\w@[(@[Z4@Z @Y@YYYdYn@YXX~@XƉWPW~WV]V]U@U@UoUoU4@UU@U'UU3@U>U>U>U@U@U@U@T@Td@T7@T)IT)IT$SZN@SZN@SZN@S0@SSK@RURRRkRIgR0[@R7Q@Q@QMQQֵ@Qֵ@Q@QQQh@PP@P|@P@PvPuc@Pl(Pw@P O@OG@OORO"OD@O O}@O|7Oz@Ou@OtNOpZ@OleOk@OiOiOhq@Ohq@Ohq@OWMOWMO3@OO (@O NxNؽNl@Nσ@Nk@N@N@N]Nw.N?N7N%qN +M@M@M@M@M@M@M@M@Mp@Mn1@MlMbSMbSMZjMRMOMN@MF@M>@M9u@M9u@M5M5Lq@La?@LH2L-L+1L%@L@LGK^K^KuKыKK@KrKy7@Kl@Kl@Kl@KjKie@Kd@KXAKG@KG@KEKA@K*@K@K@K@KK @KKJ2@J1@JjJJQJzJlE@JeJd\@J:,@J7@J2C@J&eJ I@Io@II@I@IԨI@IyIyI@II@I@II@I2III@IIU@IU@II&@I&@II@I=@IIBR@IBR@I>]I6tI6tI6tI5#@I3I2@I1.I @II @IHH!@H,Hf@H}@H@H@HpH@H@HH5@H@H@H@H|@H{?HxHwK@HuHt@Ht@Ht@HsVG Michal Domonkos - 4.11.3-48Michal Domonkos - 4.11.3-47Michal Domonkos - 4.11.3-46Michal Domonkos - 4.11.3-45Michal Domonkos - 4.11.3-44Panu Matilainen - 4.11.3-43Pavlina Moravcova Varekova C?d  Q"* 9T~      8Vt   (89T:G H $I <X DY P\ t] ^ b Id e f l tuv4wxy(,D T kghCmod_limitipconn0.2314.el7Simultaneous connection limiting module for ApacheApache module which allows web server administrators to limit the number of simultaneous downloads permitted from a single IP address.Sbuildhw-02.phx2.fedoraproject.org|Fedora ProjectFedora ProjectASL 2.0Fedora ProjectSystem Environment/Daemonshttp://dominia.org/djao/limitipconn2.htmllinuxx86_64 - 0.23-14Joe Orton - 0.23-13Fedora Release Engineering - 0.23-12Fedora Release Engineering - 0.23-11Fedora Release Engineering - 0.23-10Joe Orton - 0.23-9Joe Orton - 0.23-8Joe Orton - 0.23-7Matthias Saou 0.23-6Fedora Release Engineering - 0.23-5Fedora Release Engineering - 0.23-4Fedora Release Engineering - 0.23-3Fedora Release Engineering - 0.23-2Matthias Saou 0.23-1- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_Mass_Rebuild- fix _httpd_mmn expansion in absence of httpd-devel- Rebuilt for https://fedoraproject.org/wiki/Fedora_20_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- add _httpd_moddir compat macro as well (#809730)- improve handling of absent content-type w/2.4- update for 2.4 (patch from Jan Kaluza, #809730)- Rebuild for new apache httpd... not, we will require patching. - Use rpm macros provided by the httpd-devel package, with sane fallbacks.- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuix`XP`X 0p<$)<_R xsgbVQE@4/# ythcWRFA50$ z u i d X S G B 6 1 %    { v j e Y T H C 7 2 & !    | w k f Z U I D 8 3 ' "    } x l g [ V J E 9 4 ( #     ~ y m h \ W K F : 5 ) $     zni]XLG;6*%{oj^YMH<7+& |pk_ZNI=8,' }ql`[OJ>9-( ~rma\PK?:.) snb]QL@;/ }~aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐aH̐}TQ TNs< \}TI dɚlE8ɚT3dv dɚd3ɚ8?w lɚH8C`^%ɚnzɚɚ f`!D]t14ɚ!ɚh `!,Ttɚh:C!vJ| 0ɚG`!I|\ɚ`!AIX}ɚ',ɚN,C!H{ɚXKXɚLɚC!GɚC!F &ɚLɚC!EwH#ɚp9[`fɚh.C!=HM\ _lɚ%5^2x^ "4j~ɚ9p{a5uɚYsɚY\o2n "mLkiV2`*fLe15b/Ca1,^-][1Z,0X"W1|V . "TTFS1xR`QvjP~1N AM:LhKh1 J@3ILH>1HF VEFyC0ȓBA|#@[/?0T!>cл=s<Ɏ;0C:)8 70$68|u5@4|3hR30?2(\)1T0d/\/0t.,S-,,v8I+T+.) (,C' 0'0% &$Ő#6<#W0t"w!+\2 |RD..e6D||Lt/d-}($zM Z}@'0%'x]uyA$v}< ?'(:}' l  h }>u D"&fn=l~Dz n x(PXWP $n@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ /usr/sbin/useraddphp56-php-common(x86-64)systemd-unitssystemd-unitssystemd-unitssystemd-unitssystemd-sysv/bin/sh/bin/sh/bin/sh/bin/sh/bin/shrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)libacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.2)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libc.so.6(GLIBC_2.8)(64bit)libcom_err.so.2()(64bit)libcrypt.so.1()(64bit)libcrypto.so.10()(64bit)libcrypto.so.10(OPENSSL_1.0.1_EC)(64bit)libcrypto.so.10(OPENSSL_1.0.2)(64bit)libcrypto.so.10(libcrypto.so.10)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libgssapi_krb5.so.2()(64bit)libk5crypto.so.3()(64bit)libkrb5.so.3()(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libnsl.so.1()(64bit)libpcre.so.1()(64bit)libresolv.so.2()(64bit)libresolv.so.2(GLIBC_2.2.5)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.2.5)(64bit)libssl.so.10()(64bit)libssl.so.10(libssl.so.10)(64bit)libsystemd.so.0()(64bit)libsystemd.so.0(LIBSYSTEMD_209)(64bit)libxml2.so.2()(64bit)libxml2.so.2(LIBXML2_2.4.30)(64bit)libxml2.so.2(LIBXML2_2.5.2)(64bit)libxml2.so.2(LIBXML2_2.6.0)(64bit)libxml2.so.2(LIBXML2_2.6.11)(64bit)libz.so.1()(64bit)rtld(GNU_HASH)rpmlib(PayloadIsXz)5.6.40-41.el7.remi4.6.0-14.0-13.0.4-15.2-14.11.3if [ -f /etc/rc.d/init.d/php56-php-fpm ]; then # Save the current service runlevel info # User must manually run systemd-sysv-convert --apply php-fpm # to migrate them to systemd targets /usr/bin/systemd-sysv-convert --save php56-php-fpm >/dev/null 2>&1 || : # Run these because the SysV package being removed won't do them /sbin/chkconfig --del php56-php-fpm >/dev/null 2>&1 || : /bin/systemctl try-restart php56-php-fpm.service >/dev/null 2>&1 || : fiphp56-php-fpmf_f@dE@d@dq@cwcc2b=aKapa7T@a'@`ٹ``N@`@_@_s!_)M^@^^p^M#@^K^)]@]@]fl]@1@]G@\"\8\N\\@\~d\}@\E@\5@\[^[[~[P}@ZmZ@Z`@ZZLY|YY@Y^&@Y^&@XXXX@XoXIK@X6@X#X=XW@Wڍ@WiWW.@W@W~D@Wu Wj}WYZ@WF@W4p@W!@W@V@V@V@V'@VŲ@VVT@V@VVii@VV@VD@V2 @V@V U@U6@UL@UUVU@Uyx@Ug@UUUB@U?v@U/@U'@UU @T9T@TTC@TTp@T5Tw@TuThTd@TVT?@T.Tk@SSSr @S,)S?SR@R@R@RRRRR_@R:@RQ@QY@QY@QQQ@Q@QQyQfQ@j@P@PѬ@PP@P@P*P@P@P)P)PPPPPP5@P{Px@Pl(Pj@PiPiPe@P`K@PYPYPYPXb@PWPS@P2&P.2@P H@O@O@O O@O\@Os@O@O@OvOtNOpZ@OpZ@OP@O?O-OO@O @NNN@N@N @NoENS@NLN7@MMMMTMtMk@MfH@MRM'@M@M@MgL8LΫLʷ@LLH2K@K@KCK@K @KK@J@JlE@J_@J_@J\s@JY@J> I'@I@II@I@I}I|T@Iy@ICI>]I:i@I9I*@I9@H˫@H(H{?Hv@GGZ@Gt@GVGVGV@FFڥF@FS@FS@F]FFw@FiDFAF@f@F; @F @F@Eّ@EK@EE3@Eu_@El$El$Ej@E[@E[@EG:E#@D,@D@DbDbD(@DtJDlaD_2DX@D;@C@CCQ@CˊCǖ@C @CCf@CqC @C@C7@C@Cs6@CoACgXC(BiB{\@BwgBlB] B] B] B[@BZfBQ,@BM7BJBBBB @A@AAA_A_A_AJAJAJA@EA @Ag@Remi Collet - 5.6.40-41Remi Collet - 5.6.40-40Remi Collet - 5.6.40-39Remi Collet - 5.6.40-38Remi Collet - 5.6.40-37Remi Collet - 5.6.40-36Remi Collet - 5.6.40-35Remi Collet - 5.6.40-34Remi Collet - 5.6.40-33Remi Collet - 5.6.40-32Remi Collet - 5.6.40-31Remi Collet I'@I@II@I@I}I|T@Iy@ICI>]I:i@I9I*@I9@H˫@H(H{?Hv@GGZ@Gt@GVGVGV@FFڥF@FS@FS@F]FFw@FiDFAF@f@F; @F @F@Eّ@EK@EE3@Eu_@El$El$Ej@E[@E[@EG:E#@D,@D@DbDbD(@DtJDlaD_2DX@D;@C@CCQ@CˊCǖ@C @CCf@CqC @C@C7@C@Cs6@CoACgXC(BiB{\@BwgBlB] B] B] B[@BZfBQ,@BM7BJBBBB @A@AAA_A_A_AJAJAJA@EA @Ag@Remi Collet - 8.0.30-6Remi Collet - 8.0.30-5Remi Collet - 8.0.30-4Remi Collet - 8.0.30-3Remi Collet - 8.0.30-2Remi Collet - 8.0.30-1Remi Collet - 8.0.29-1Remi Collet - 8.0.28-4Remi Collet - 8.0.28-3Remi Collet - 8.0.28-2Remi Collet - 8.0.28-1Remi Collet - 8.0.27-1Remi Collet - 8.0.26-1Remi Collet - 8.0.26~RC1-1Remi Collet - 8.0.25-1Remi Collet - 8.0.25~RC1-1Remi Collet - 8.0.24-1Remi Collet - 8.0.24~RC1-1Remi Collet - 8.0.23-1Remi Collet - 8.0.23~RC1-1Remi Collet - 8.0.22-1Remi Collet - 8.0.22~RC1-2Remi Collet - 8.0.22~RC1-1Remi Collet - 8.0.21-2Remi Collet - 8.0.21-1Remi Collet - 8.0.21~RC1-1Remi Collet - 8.0.20-1Remi Collet - 8.0.20~RC1-2Remi Collet - 8.0.20~RC1-1Remi Collet - 8.0.19-1Remi Collet - 8.0.19~RC1-1Remi Collet - 8.0.18-1Remi Collet - 8.0.18~RC1-1Remi Collet - 8.0.17-1Remi Collet - 8.0.17~RC1-1Remi Collet - 8.0.16-2Remi Collet - 8.0.16-1Remi Collet - 8.0.16~RC1-1Remi Collet - 8.0.15-1Remi Collet - 8.0.15~RC1-1Remi Collet - 8.0.14-1Remi Collet - 8.0.14~RC1-2Remi Collet - 8.0.14~RC1-1Remi Collet - 8.0.13-1Remi Collet - 8.0.13~RC1-1Remi Collet - 8.0.12-3Remi Collet - 8.0.12-2Remi Collet - 8.0.12-1Remi Collet - 8.0.12~RC1-2Remi Collet - 8.0.12~RC1-1Remi Collet - 8.0.11-1Remi Collet - 8.0.11~RC1-1Remi Collet - 8.0.10-1Remi Collet - 8.0.10~RC1-2Remi Collet - 8.0.10~RC1-1Remi Collet - 8.0.9-2Remi Collet - 8.0.9-1Remi Collet - 8.0.9~RC1-1Remi Collet - 8.0.8-1Remi Collet - 8.0.8~RC1-1Remi Collet - 8.0.7-1Remi Collet - 8.0.7~RC1-1Remi Collet - 8.0.6-2Remi Collet - 8.0.6-1Remi Collet - 8.0.5-1Remi Collet - 8.0.5~RC1-1Remi Collet - 8.0.4~RC1-1Remi Collet - 8.0.3-1Remi Collet - 8.0.3~RC1-1Remi Collet - 8.0.2-1Remi Collet - 8.0.2~RC1-2Remi Collet - 8.0.2~RC1-1Remi Collet - 8.0.1-1Remi Collet - 8.0.1~RC1-2Remi Collet - 8.0.1~RC1-1Remi Collet - 8.0.0-2Remi Collet - 8.0.0-1Remi Collet - 8.0.0~rc5-38Remi Collet 5.6.11-0.1.RC1Remi Collet 5.6.10-1Remi Collet 5.6.10-0.1.RC1Remi Collet 5.6.9-1Remi Collet 5.6.9-0.1.RC1Remi Collet 5.6.8-2Remi Collet 5.6.8-1Remi Collet 5.6.8-0.2.RC1Remi Collet 5.6.8-0.1.RC1Remi Collet 5.6.7-1Remi Collet 5.6.7-0.1.RC1Remi Collet 5.6.6-1Remi Collet 5.6.5-1Remi Collet 5.6.5-0.2.RC1Remi Collet 5.6.5-0.1.RC1Remi Collet 5.6.4-2Remi Collet 5.6.4-1Remi Collet 5.6.4-0.1.RC1Remi Collet 5.6.3-3Remi Collet 5.6.3-2Remi Collet 5.6.3-1Remi Collet 5.6.3-0.1.RC1Remi Collet 5.6.2-1Remi Collet 5.6.1-1Remi Collet 5.6.0-1.1Remi Collet 5.6.0-1Remi Collet - 5.6.0-0.1.RC4Remi Collet - 5.5.6-10Remi Collet - 5.5.6-9Remi Collet - 5.5.6-8Remi Collet - 5.5.6-7Remi Collet - 5.5.6-6Remi Collet - 5.5.6-5Remi Collet - 5.5.6-4Remi Collet 5.5.6-2Remi Collet 5.5.6-0Remi Collet 5.5.5-1Remi Collet 5.5.4-1Remi Collet 5.5.3-1Remi Collet 5.5.1-1Remi Collet 5.4.16-6Remi Collet 5.4.16-5Remi Collet 5.4.16-4Remi Collet - 5.4.16-3Remi Collet 5.4.16-2Remi Collet 5.4.16-1Remi Collet 5.4.14-3Remi Collet 5.4.14-2Remi Collet 5.4.14-1Remi Collet 5.4.13-1Remi Collet 5.4.11-1Remi Collet 5.4.10-1Remi Collet 5.4.9-1Remi Collet 5.4.8-7Remi Collet 5.4.8-6Remi Collet 5.4.8-5Remi Collet 5.4.8-6Remi Collet 5.4.8-4Remi Collet 5.4.8-4Remi Collet 5.4.8-3Joe Orton - 5.4.8-2Remi Collet 5.4.8-3Remi Collet 5.4.8-2.1Remi Collet 5.4.8-2Remi Collet 5.4.8-1.2Remi Collet 5.4.8-1Remi Collet 5.4.7-4Remi Collet 5.4.7-3Remi Collet 5.4.7-2Remi Collet 5.4.7-1Remi Collet 5.4.7-10Remi Collet 5.4.7-9Remi Collet 5.4.7-8Remi Collet 5.4.7-7Remi Collet 5.4.7-6Remi Collet 5.4.7-5Remi Collet 5.4.7-4Remi Collet 5.4.7-3Remi Collet 5.4.7-2Remi Collet 5.4.7-1Remi Collet 5.4.6-2Remi Collet 5.4.6-1Remi Collet 5.4.5-1Remi Collet 5.4.4-4Remi Collet 5.4.4-3Remi Collet 5.4.4-2Remi Collet 5.4.4-1Remi Collet 5.4.3-1Remi Collet 5.4.2-1Remi Collet 5.4.1-1Joe Orton - 5.4.0-6Remi Collet 5.4.0-5Joe Orton - 5.4.0-4Joe OrxXjW8ku$muuuKalev Lember - 0.50.2-2Jon Ciesla - 0.50.2-1Fedora Release Engineering - 0.50.0-2Alon Levy Fedora Release Engineering - 0.41.1-2Matthias Clasen - 0.41.1-1Matthias Clasen - 0.41.0-1Ville Skyttä - 0.40.6-4Fedora Release Engineering - 0.40.6-3Matthias Clasen - 0.40.6-2Matthias Clasen - 0.40.6-1Fedora Release Engineering - 0.40.5-3Matthias Clasen - 0.40.5-2Matthias Clasen - 0.40.5-1Matthias Clasen - 0.40.4-1Matthias Clasen - 0.40.3-3Tom "spot" Callaway - 0.40.3-2Matthias Clasen - 0.40.3-1Matthias Clasen - 0.40.1-1Matthias Clasen - 0.40.0-1Matthias Clasen - 0.37.1-1Fedora Release Engineering - 0.37.0-3Matthias Clasen - 0.37.0-2Matthias Clasen - 0.37.0-1Matthias Clasen - 0.36.3-1Matthias Clasen - 0.36.2-1Matthias Clasen - 0.36.1-1Matthias Clasen - 0.36.0-1David Zeuthen - 0.35.5-5Matthias Clasen - 0.35.5-4Ray Strode - 0.35.5-3Bill Nottingham - 0.35.5-2Matthias Clasen - 0.35.5-1Matthias Clasen - 0.35.4-1Matthias Clasen - 0.35.2-1Matthias Clasen - 0.35.0-2Jesse Keating - 0.35.0-1.1Matthias Clasen 0.35.0-1Matthias Clasen 0.34.90.cvs20060509-1Jesse Keating - 0.34.2-1.1Matthias Clasen 0.34.2-1Jesse Keating Matthias Clasen - 0.34.1-1Matthias Clasen - 0.33-2Matthias Clasen - 0.33-1Jeremy Katz - 0.31.2-3 - 0.31.2-1Jonathan Blandford 0.31.2-1Owen Taylor - 0.31.1-1Elliot Lee Alex Larsson 0.30-1Elliot Lee Jonathan Blandford 0.29-1Alexander Larsson 0.27.2-1Havoc Pennington 0.27-1Havoc Pennington 0.26-1Havoc Pennington 0.26-1Elliot Lee Tim Powers Havoc Pennington Havoc Pennington Tim Powers Havoc Pennington Havoc Pennington Nalin Dahyabhai Tim Powers Havoc Pennington Jeremy Katz Jeremy Katz Jeremy Katz Havoc Pennington Owen Taylor Tim Powers Havoc Pennington Havoc Pennington Havoc Pennington Havoc Pennington Alexander Larsson 0.9-2Jonathan Blandford Trond Eivind Glomsrød Tim Powers Jonathan Blandford Maciej Stachowiak Robin * Slomkowski - Backport an upstream patch to fix DATADIRNAME substitution - Resolves: #1422632- Mass rebuild 2013-12-27- Update url (#908562)- Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Clean up previous change and fix Requires/BuildRequires (#225902)- Latest stable release. - Merge review BZ 225902 fixes: - Removed Obsoletes/Provides for xml-i18n-tools. - Swapped gettext/gettext-devel Requires, BuildRequires. - Added %check sectixXVH gI$wgIfIhIancesco Giudici - 1:1.10.2-13Beniamino Galvani - 1:1.10.2-12Lubomir Rintel - 1:1.10.2-11Beniamino Galvani - 1:1.10.2-10Lubomir Rintel - 1:1.10.2-9Lubomir Rintel - 1:1.10.2-7Thomas Haller - 1:1.10.2-6Beniamino Galvani - 1:1.10.2-5Beniamino Galvani - 1:1.10.2-4Thomas Haller - 1:1.10.2-3Lubomir Rintel - 1:1.10.2-2Beniamino Galvani - 1:1.10.2-1Thomas Haller - 1:1.10.0-2Beniamino Galvani - 1:1.10.0-1Beniamino Galvani - 1:1.10.0-0.2.rc1Beniamino Galvani - 1:1.10.0-0.1.git20171024.b16c853bThomas Haller - 1:1.8.0-11Beniamino Galvani - 1:1.8.0-10Thomas Haller - 1:1.8.0-9Beniamino Galvani - 1:1.8.0-8Thomas Haller - 1:1.8.0-7Thomas Haller - 1:1.8.0-6Thomas Haller - 1:1.8.0-5Beniamino Galvani - 1:1.8.0-4Thomas Haller - 1:1.8.0-3Thomas Haller - 1:1.8.0-2Thomas Haller - 1:1.8.0-1Lubomir Rintel - 1:1.8.0-0.4.rc3Lubomir Rintel - 1:1.8.0-0.4.rc2Lubomir Rintel - 1:1.8.0-0.4.rc1Thomas Haller - 1:1.8.0-0.3.git20170215.1d40c5f4Francesco Giudici - 1:1.8.0-0.2.git20170215.1d40c5f4Lubomir Rintel - 1:1.4.0-13.3Thomas Haller - 1:1.4.0-13.1Thomas Haller - 1:1.4.0-13Lubomir Rintel - 1:1.4.0-12Thomas Haller - 1:1.4.0-11Thomas Haller - 1:1.4.0-10Beniamino Galvani - 1:1.4.0-9Thomas Haller - 1:1.4.0-8Thomas Haller - 1:1.4.0-7Lubomir Rintel - 1:1.4.0-6Thomas Haller - 1:1.4.0-5Thomas Haller - 1:1.4.0-4Thomas Haller - 1:1.4.0-3Thomas Haller - 1:1.4.0-2Lubomir Rintel - 1:1.4.0-1Thomas Haller - 1:1.4.0-0.6.beta1Beniamino Galvani - 1:1.4.0-0.5.beta1Lubomir Rintel - 1:1.4.0-0.4.git20160727.9446481fLubomir Rintel - 1:1.4.0-0.3.git20160727.9446481fLubomir Rintel - 1:1.4.0-0.3.git20160621.072358daBeniamino Galvani - 1:1.4.0-0.2.git20160621.072358daBeniamino Galvani - 1:1.4.0-0.1.git20160606.b769b4dfThomas Haller - 1:1.2.0-2Lubomir Rintel - 1:1.2.0-1Lubomir Rintel - 1:1.2.0-0.1.beta3Lubomir Rintel - 1:1.2.0-0.1.beta2Thomas Haller - 1:1.0.6-28Thomas Haller - 1:1.0.6-27Jiří Klimeš - 1:1.0.6-26Lubomir Rintel - 1:1.0.6-25Jiří Klimeš - 1:1.0.6-24Beniamino Galvani - 1:1.0.6-23Thomas Haller - 1:1.0.6-22Thomas Haller - 1:1.0.6-21Thomas Haller - 1:1.0.6-20Thomas Haller - 1:1.0.6-19Beniamino Galvani - 1:1.0.6-18Thomas Haller - 1:1.0.6-17Lubomir Rintel - 1:1.0.6-16Thomas Haller - 1:1.0.6-15Thomas Haller - 1:1.0.6-14Lubomir Rintel - 1:1.0.6-13Dan Williams - 1:1.0.6-12Thomas Haller - 1:1.0.6-11Thomas Haller - 1:1.0.6-10Jiří Klimeš - 1:1.0.6-9JxXWko $o p n otrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-DBI-1.627-4.el7.src.rpmperl(Bundle::DBI)perl(DBD::DBM)perl(DBD::DBM::Statement)perl(DBD::DBM::Table)perl(DBD::DBM::db)perl(DBD::DBM::dr)perl(DBD::DBM::st)perl(DBD::ExampleP)perl(DBD::File)perl(DBD::File::DataSource::File)perl(DBD::File::DataSource::Stream)perl(DBD::File::Statement)perl(DBD::File::Table)perl(DBD::File::TableSource::FileSystem)perl(DBD::File::db)perl(DBD::File::dr)perl(DBD::File::st)perl(DBD::Gofer)perl(DBD::Gofer::Policy::Base)perl(DBD::Gofer::Policy::classic)perl(DBD::Gofer::Policy::pedantic)perl(DBD::Gofer::Policy::rush)perl(DBD::Gofer::Transport::Base)perl(DBD::Gofer::Transport::null)perl(DBD::Gofer::Transport::pipeone)perl(DBD::Gofer::Transport::stream)perl(DBD::NullP)perl(DBD::Proxy)perl(DBD::Proxy::db)perl(DBD::Proxy::dr)perl(DBD::Proxy::st)perl(DBD::Sponge)perl(DBDI)perl(DBI)perl(DBI::Const::GetInfo::ANSI)perl(DBI::Const::GetInfo::ODBC)perl(DBI::Const::GetInfoReturn)perl(DBI::Const::GetInfoType)perl(DBI::DBD)perl(DBI::DBD::Metadata)perl(DBI::DBD::SqlEngine)perl(DBI::DBD::SqlEngine::DataSource)perl(DBI::DBD::SqlEngine::Statement)perl(DBI::DBD::SqlEngine::Table)perl(DBI::DBD::SqlEngine::TableSource)perl(DBI::DBD::SqlEngine::TieMeta)perl(DBI::DBD::SqlEngine::TieTables)perl(DBI::DBD::SqlEngine::db)perl(DBI::DBD::SqlEngine::dr)perl(DBI::DBD::SqlEngine::st)perl(DBI::FAQ)perl(DBI::Gofer::Execute)perl(DBI::Gofer::Request)perl(DBI::Gofer::Response)perl(DBI::Gofer::Serializer::Base)perl(DBI::Gofer::Serializer::DataDumper)perl(DBI::Gofer::Serializer::Storable)perl(DBI::Gofer::Transport::Base)perl(DBI::Gofer::Transport::pipeone)perl(DBI::Gofer::Transport::stream)perl(DBI::Profile)perl(DBI::ProfileData)perl(DBI::ProfileDumper)perl(DBI::ProfileDumper::Apache)perl(DBI::ProfileSubs)perl(DBI::ProxyServer)perl(DBI::ProxyServer::db)perl(DBI::ProxyServer::dr)perl(DBI::ProxyServer::st)perl(DBI::SQL::Nano)perl(DBI::SQL::Nano::Statement_)perl(DBI::SQL::Nano::Table_)perl(DBI::Util::CacheMemory)perl(DBI::Util::_accessor)perl(DBI::common)perl-DBIperl-DBI(x86-64)@@@@@@@ @ @ @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ @ @@@@@@@@@@@   @ /usr/bin/perllibc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)perlperlperlperl(:MODULE_COMPAT_5.16.3)perl(Carp)perl(Config)perl(Cwd)perl(DBD::File)perl(DBD::Gofer::Policy::Base)perl(DBD::Gofer::Transport::Base)perl(DBD::Gofer::Transport::pipeone)perl(DBI)perl(DBI::Const::GetInfo::ANSI)perl(DBI::Const::GetInfo::ODBC)perl(DBI::Const::GetInfoType)perl(DBI::DBD::SqlEngine)perl(DBI::Gofer::Execute)perl(DBI::Gofer::Request)perl(DBI::Gofer::Response)perl(DBI::Gofer::Serializer::Base)perl(DBI::Gofer::Serializer::DatxXWh>c$.>c?c=\?<d " bAE Qg{    " $,6@hp`(8 9 :5 GHIXY\]^b5defl LP`_ _ HLPgThXCphp55-php-gd5.5.3813.el7.remiA module for PHP applications for using the gd graphics libraryThe php55-php-gd package contains a dynamic shared object that will add support for using the gd graphics library to PHP.bbuilder.remirepo.netحRemi's RPM repository #StandWithUkrainePHPRemi ColletDevelopment/Languageshttp://www.php.net/linuxx86_64-؀b b8fb85262f8f5083844c716f96d27e92adb08c7437b5588225422e5262e677ccedb695c8e4e2a34ab8fa5e0b773c00d43940d607a1fb055b991969da5bb05237drootrootrootrootphp55-php-5.5.38-13.el7.remi.src.rpmphp55-php-gdphp55-php-gd(x86-64)   @@@@@@@@@@@@ php55-php-common(x86-64)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)libX11.so.6()(64bit)libXpm.so.4()(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)libfreetype.so.6()(64bit)libgd.so.103()(64bit)libjpeg.so.62()(64bit)libpng15.so.15()(64bit)libt1.so.5()(64bit)libz.so.1()(64bit)rtld(GNU_HASH)rpmlib(PayloadIsXz)5.5.38-13.el7.remi4.6.0-14.0-13.0.4-15.2-14.11.3bU]@\8@\U@[Z@X7@XK@X#X@W@W^@WWgWu Wi,@WEW Vn@VaVV@VV @U6@UL@U@UUx&UeUT@U@U?v@U.RUU @T9T~TTC@Tq@Tp@T5TuThTd@TVT?@Tl@TwTSr @S,)S?SR@R@R@RRRRR_@R:@RQ@QY@QY@QQQ@Q@QQyQfQ@j@P@PѬ@PP@P@P*P@P@P)P)PPPPPP5@P{Px@Pl(Pj@PiPiPe@P`K@PYPYPYPXb@PWPS@P2&P.2@P H@O@O@O O@O\@Os@O@O@OvOtNOpZ@OpZ@OP@O?O-OO@O @NNN@N@N @NoENS@NLN7@MMMMTMtMk@MfH@MRM'@M@M@MgL8LΫLʷ@LLH2K@K@KCK@K @KK@J@JlE@J_@J_@J\s@JY@J> I'@I@II@I@I}I|T@Iy@ICI>]I:i@I9I*@I9@H˫@H(H{?Hv@GGZ@Gt@GVGVGV@FFڥF@FS@FS@F]FFw@FiDFAF@f@F; @F @F@Eّ@EK@EE3@Eu_@El$El$Ej@E[@E[@EG:E#@D,@D@DbDbD(@DtJDlaD_2DX@D;@C@CCQ@CˊCǖ@C @CCf@CqC @C@C7@C@Cs6@CoACgXC(BiB{\@BwgBlB] B] B] B[@BZfBQ,@BM7BJBBBB @A@AAA_A_A_AJAJAJA@EA @Ag@Remi Collet - 5.5.38-13Remi Collet - 5.5.38-12Remi Collet - 5.5.38-11Remi Collet - 5.5.38-10Remi Collet - 5.5.38-9Remi Collet - 5.5.38-8Remi Collet - 5.5.38-7Remi Collet - 5.5.38-6Remi Collet - 5.5.38-5Remi Collet - 5.5.38-4Remi Collet 5.5.38-3Remi Collet 5.5.38-2Remi Collet 5.5.38-1.1Remi Collet 5.5.38-1Remi Collet 5.5.37-1.1Remi Collet 5.5.37-1Remi Collet 5.5.36-1Remi Collet 5.5.35-1Remi Collet R(WvƒENN3nܩO2Meqdgei˫]Slї56(Lp?X ۲e$rR:< ]#P7F>m+xW,?u mӠ_WH\QU%$rWeM-@;QxgB LrpGhm g-GxQk)0ݧ1jYj2q\hU*.dP}QisrKgBp(!kUa9 |P?rZhMfph.w/($aUq=坎O-|_I2$ƨLu>YDۨYXL9c&x$9x}%V}jު+Ge[u;c%鮬N7X,2qu`ؿIЫb[Dd}=cHʚaՒ+xq dcm-BPR ǻ6%6.^a 㪠 ƒysrß1m.e&dj@ձD,-=9RKo퐎9آYlt{TaNEo9ݕ.{x(TvgD|h:jW -?o;&ȱf?E#e&}>͗`\6?Vmx 5tBeC*a98086e808d48882f59f6ca32b70de269996ee16db#Vbgs default values (Don Dutile) [1382806 1417285] - [infiniband] ib/hfi1: Remove redundant sysfs irq affinity entry (Don Dutile) [1382806 1417285] - [infiniband] ib/rdmavt: rdmavt can handle non aligned page maps (Don Dutile) [1385848 1417285] - [infiniband] shut up a maybe-uninitialized warning (Don Dutile) [1417285] - [net] xprtrdma: Fix DMAR failure in frwr_op_map() after reconnect (Don Dutile) [1417285] - [netdrv] mlx5: Fix invalid pointer reference when prof_sel parameter is invalid (Don Dutile) [1385330 1417285] - [netdrv] mlx5: E-Switch, Set the actions for offloaded rules properly (Don Dutile) [1385330 1417285] - [netdrv] mlx5e: Disallow changing name-space for VF representors (Don Dutile) [1385330 1417285] - [netdrv] cxgb4: correct device ID of T6 adapter (Don Dutile) [1385866 1417285] - [net] svcrdma: backchannel cannot share a page for send and rcv buffers (Don Dutile) [1417285] - [netdrv] mlx5: Simplify a test (Don Dutile) [1385330 1417285] - [netdrv] mlx4_en: Save slave ethtool stats command (Don Dutile) [1385329 1417285] - [netdrv] mlx4_en: Fix potential deadlock in port statistics flow (Don Dutile) [1385329 1417285] - [kernel] mlx4: Fix firmware command timeout during interrupt test (Don Dutile) [1385329 1417285] - [netdrv] mlx4_core: Do not access comm channel if it has not yet been initialized (Don Dutile) [1385329 1417285] - [netdrv] mlx4_en: Process all completions in RX rings after port goes up (Don Dutile) [1385329 1417285] - [netdrv] mlx4_en: Resolve dividing by zero in 32-bit system (Don Dutile) [1385329 1417285] - [netdrv] mlx4_core: Change the default value of enable_qos (Don Dutile) [1385329 1417285] - [netdrv] mlx4_core: Avoid setting ports to auto when only one port type is supported (Don Dutile) [1385329 1417285] - [netdrv] mlx4_core: Fix the resource-type enum in res tracker to conform to FW spec (Don Dutile) [1385329 1417285] - [net] rds: debug messages are enabled by default (Don Dutile) [1417285] - [netdrv] cxgb4: Fix error handling in alloc_uld_rxqs() (Don Dutile) [1385866 1417285] - [netdrv] ib/mlx4: avoid a -Wmaybe-uninitialize warning (Don Dutile) [1385329 1417285] - [netdrv] mlx5: Avoid passing dma address 0 to firmware (Don Dutile) [1385330 1417285] - [kernel] mlx5: PCI error recovery health care simulation (Don Dutile) [1385330 1417285] - [kernel] mlx5: Fix race between PCI error handlers and health work (Don Dutile) [1385330 1417285] - [netdrv] mlx5: Clear health sick bit when starting health poll (Don Dutile) [1385330 1417285] - [netdrv] mlx5: Change the acl enable prototype to return status (Don Dutile) [1385330 1417285] - [netdrv] mlx5e: Unregister netdev before detaching it (Don Dutile) [1385330 1417285] - [netdrv] mlx5e: Choose best nearest LRO timeout (Don Dutile) [1385330 1417285] - [netdrv] mlx5: Correctly initialize last use of flow counters (Don Dutile) [1385330 1417285] - [netdrv] mlx5: Fix autogroups groups num not decreasing (Don Dutile) [1385330 1417285] - [netdrv] mlx5: Keep autogroups list ordered (Don Dutile) [1385330 1417285] - [netdrv] mlx5: Always Query HCA caps afterxX9W}iu$yiuhujut-python3 shouldn't be under the overall boost umbrella- Enable Python 3 builds. This is still disabled in Boost MPI, which doesn't seem to support Python 3- Upstream 1.50 - boost-cmake-soname.patch drop, upstream handles soname well, and we haven't been doing manual numbering for several years now - boost-1.48.0-cmakeify-full.patch drop, not necessary for bjam - Rebase many patches, port others, courtesy of Denis Arnaud: - boost-1.48.0-exceptions.patch drop - boost-1.48.0-lexical_cast-incomplete.patch drop - boost-1.48.0-gcc47-pthreads.patch drop - boost-1.48.0-long-double.patch drop - boost-1.48.0-xtime.patch drop - boost-1.48.0-locale.patch drop - boost-1.48.0-signals-erase.patch port - boost-1.48.0-fix-non-utf8-files.patch port - boost-1.48.0-foreach.patch port - boost-1.48.0-attribute.patch port - boost-1.48.0-long-double-1.patch port - boost-1.48.0-polygon.patch port - boost-1.48.0-pool.patch port- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Build Boost.Locale backends - Resolves: #832265- In Boost.Pool, be careful not to overflow allocated chunk size. - Resolves: #828857- Don't attempt to install Python 3 portions of boost when given --without python3 - glibc newly defines a macro TIME_UTC, which collides with boost::TIME_UTC. We can't avoid expanding that macro, but the value happens to be the same as that of boost::TIME_UTC. So drop enum xtime_clock_types. Update boost to use macro TIME_UTC instead of the scoped enum value. External clients will have to do the same. - Resolves: #824810 - BR on hwloc-devel shouldn't be required anymore (see #814798)- Support building boost-python against Python 3 - Resolves: #807780- Included -math subpackage into umbrella package - Added missing /sbin/ldconfig for -math subpackage- Add hwloc-devel BR to work around a probable bug in openmpi-devel which fails to pull it in- Rebuilt for c++ ABI breakage- Only build the long double math libraries on arches that support long double. - ARM was considered unsupporting, because libc defines __NO_LONG_DOUBLE_MATH. Ignore this setting, ARM has perfectly working long double that just happens to be only as long as double. - Resolves: #783660 - Add a missing sort adaptor include to boost polygon - Resolves: #784654- Add underscores around several uses of __attribute__((X)) to prevent interactions with user-defined macro X - Resolves: #781859- Added source source files for mingw cross-compilation of Boost.Locale. - Resolves: #781751- Added the Boost.Timer sub-package. Resolves: #772397- Integrated into "upstream" (CMake-ified Boost) the Boost.TR1/Math patch.- Build math portion of Boost.TR1, package DSOs in boost-math. - Resolves: #771370- Add an upstream patch for BOOST_ENABLE_THREADS- Add an upstream patch for BOOST_FOREACH declaration issue #756005 - Add a proposed patch for error in boost lexical_cast #757385- Upgrade to Boost-1.48.0, adding two new header-only components (Container and Move) and a new library (Locale). - Resolves: #754865 - Added a patch with a manual page for the bjam executable. - Added a patch to fix the non-UTF8-encoded example source file. - Re-worked a little bit the example section, so as to fix the DOS-formatted and the ISO-8859-encoded files.- Use instead of C++11 header in boost math. - Resolves: #751210- Rebuild for libicu soname bump - Hack /bin back to PATH after MPI module unload - Resolves: #736890- Drop BR bzip2-libs, which is brought it via bzip2-devel - Source->Source0 - Drop unnecessary BuildRoot tag - Update License tag to include all licenses that are found in sources. Python license is at the main package, not to the python sub-package, because python22_fixed.h is in -devel. - Related: #673839 - Resolves: #225622- Package examples - Resolves: #722844- Convert two throws in boost/numeric/conversion to boost::throw_exception to allow compilation with -fno-exception - Resolves: #724015- Upgrade to Boosx`XvWp Ц$z90x (with gcc -shared -fPIC).- look harder for res_mkquery() in libresolv- don't choke on large response packets- automated rebuild- automated rebuild- rebuild in new environment- add missing post/postun calls to ldconfig- rebuild in new environment- automated rebuild- actually set the soname in the shared library (ld doesn't automatically set the soname to the output file's name, oops)- on second thought, put the shared library back in, using a soversion of 0 to have a chance at providing compatibility with apps linked dynamically on other distributions - make -devel depend on the same version of the main package- remove the shared library patch -- different packages with shared libraries tend to use different sonames, so we'd run inevitably run into problems- remove pre and post scripts -- authconfig handles that stuff now - add the hesiod man page back in, as bind-devel doesn't provide it any more- hesiod-devel requires hesiod (bug #128)- remove hesiod man page from hesiod-devel as it conflicts with the one from bind-devel- use rpm macros where possible and FHS-ify - split into main and devel packages - add back requires for nscd- rebuild in new environment- rebuild in new environment- removed dependency on nscd - changed requires: nscd back to caching-nameserver- started changelog - moved addition of hesiod to nsswitch.conf to this package because we no longer use a separate libnss_hesiod.so - changed requires: caching-nameserver to nscd - added post-install script snippet to activate nscd on install/sbin/ldconfig/sbin/ldconfighesinfo 3.2.1-3.el73.2.1-3.el73.2hesinfolibhesiod.so.0libhesiod.so.0.0.0hesiod-3.2.1COPYINGNEWSREADMEhesinfo.1.gzhesiod.conf.5.gz/usr/bin//usr/lib64//usr/share/doc//usr/share/doc/hesiod-3.2.1//usr/share/man/man1//usr/share/man/man5/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=0x74b2d2bb4922ad1d3a7e864a098e423ea97dfa44, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0xa320c887e0b507e042a50c738d7e1c8c9aa01775, strippeddirectoryASCII texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression) RRRR R R RRPR R RRRRRRR R RR?@q S ;$ƨwC+d^.8e}6 xlE\Eci%C?i @sT"?%(W%SC sl[|]?eѮ|4W\Wq.p ,w+"l*^۰_W.0@qk nث<#_V{+ދ;[NI6uTS=joa"k&x@\sA`B;[z`^\Y< }T;"\?чbx_J׊@Z[Ir[F{U8aTٚ?!/+@>@>Á@>Á@>@>.=V=@= <@<6<@<<|@<<0;6@;@b@;;@;8y@:S:d79a9@9@99}@9m@9L8L@8z@8V8m83@8c`@Jan Synáček - 20160308-10Jan Synáček - 20160308-9Jan Synáček - 20160308-8Jan Synáček - 20160308-7Jan Synáček - 20160308-6Jan Synáček - 20160308-5Jan Synáček - 20160308-4Jan Synáček - 20160308-3Jan Synáček - 20160308-2Jan Synáček - 20160308-1Jan Synáček - 20150815-1Jan Synáček - 20121221-7Jan Synáček - 20121221-7Daniel Mach - 20121221-6Daniel Mach - 20121221-5Jan Synáček - 20121221-4Jan Synáček - 20121221-3Jan Synáček - 20121221-2Jan Synáček - 20121221-1Jan Synáček - 20121207-1Jan Synáček - 20121205-1Jan Synáček - 20121125-3Jan Synáček - 20121125-2Jan Synáček - 20121125-1Jan Synáček - 20121121-2Jan Synáček - 20121121-1Jan Synáček - 20121112-2Jan Synáček - 20121112-1Jan Synáček - 20121106-2Jan Synáček - 20121106-1Jan Synáček - 20121011-1Jan Synáček - 20101006-18Jan Synáček 20101006-17Jan Synáček 20101006-16Fedora Release Engineering - 20101006-16Jan Synáček 20101006-15Harald Hoyer 20101006-14Fedora Release Engineering - 20101006-13Jiri Skala - 20101006-12Jiri Skala - 20101006-11Jiri Skala - 20101006-10Jiri Skala - 20101006-9Jiri Skala - 20101006-8Jiri Skala - 20101006-7Fedora Release Engineering - 20101006-6Jiri Skala - 20101006-5Jiri Skala - 20101006-4Jiri Skala - 2010100xȉXW ƃ$VƃǃŃ - 5.4.0-6Remi Collet 5.4.0-5Joe Orton - 5.4.0-4Joe Orton - 5.4.0-3Joe Orton - 5.4.0-2Remi Collet 5.4.0-1Remi Collet 5.4.0-0.4.RC8Remi Collet 5.4.0-0.3.RC7Remi Collet 5.4.0-0.2.RC6Remi Collet 5.4.0-0.1.RC6Remi Collet 5.3.8-4.4Remi Collet 5.3.8-4.3Adam Jackson - 5.3.8-4.2Marcela Mašláňová - 5.3.8-3.2Peter Schiffer - 5.3.8-3.1Remi Collet 5.3.8-3Remi Collet 5.3.8-2Remi Collet 5.3.8-1Remi Collet 5.3.7-1Joe Orton - 5.3.6-4Remi Collet 5.3.6-3Remi Collet 5.3.6-2Remi Collet 5.3.6-1Joe Orton - 5.3.5-6Caolán McNamara 5.3.5-5Remi Collet 5.3.5-4Remi Collet 5.3.5-3Fedora Release Engineering - 5.3.5-2Remi Collet 5.3.5-1Remi Collet 5.3.4-2Remi Collet 5.3.4-1.1Remi Collet 5.3.4-1Remi Collet 5.3.3-5Joe Orton - 5.3.3-4Joe Orton - 5.3.3-3Remi Collet 5.3.3-2Remi Collet 5.3.3-1Remi Collet 5.3.2-3Caolán McNamara 5.3.2-2Remi Collet 5.3.2-1Joe Orton - 5.3.1-3Joe Orton - 5.3.1-2Remi Collet 5.3.1-1Tom "spot" Callaway - 5.3.0-7Tomas Mraz - 5.3.0-6Fedora Release Engineering - 5.3.0-5Joe Orton 5.3.0-4Joe Orton 5.3.0-3Joe Orton 5.3.0-2Remi Collet 5.3.0-1Remi Collet 5.2.10-1Remi Collet - 5.2.9-1Fedora Release Engineering - 5.2.8-10Joe Orton 5.2.8-9Joe Orton 5.2.8-8Joe Orton 5.2.8-7Joe Orton 5.2.8-5Joe Orton 5.2.8-4Joe Orton 5.2.8-3Remi Collet 5.2.8-2Remi Collet 5.2.8-1Remi Collet 5.2.7-1.1Remi Collet 5.2.7-1Joe Orton 5.2.6-7Joe Orton 5.2.6-6Remi Collet 5.2.6-5Remi Collet 5.2.6-4Joe Orton 5.2.6-3Joe Orton 5.2.5-7Fedora Release Engineering - 5.2.5-6Joe Orton 5.2.5-5Joe Orton 5.2.5-4Release Engineering - 5.2.5-3Joe Orton 5.2.5-2Joe Orton 5.2.4-3Joe Orton 5.2.4-2Joe Orton 5.2.3-9Joe Orton 5.2.3-8Hans de Goede 5.2.3-7Joe Orton 5.2.3-6Joe Orton 5.2.3-5Joe Orton 5.2.3-4Joe Orton 5.2.3-3Joe Orton 5.2.3-2Joe Orton 5.2.2-4Joe Orton 5.2.2-3Joe Orton 5.2.2-2Joe Orton 5.2.1-5Joe Orton 5.2.1-4Joe Orton 5.2.1-3Joe Orton 5.2.1-2Joe Orton 5.2.0-10Joe Ox@yXsU$ edhat-hardened-cc1 -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuhttps://forum.remirepo.net/? ĕlpMMRkTh]!LΈJ]NoGVf_} NoGVer`֯rQ`9 cݟB(4=?]!LΈJ]NoGVf_} NoGV*'X[RҤX-qmǥ ֚zf9b78737e661f0a2b3f3d0492fffe11f7033da14g vVg u- [netdrv] virtchnl: white space and reorder (Ivan Vecera) [1658270] - [net] return NULL if metadata_dst allocation fails in metadata_dst_alloc (Lorenzo Bianconi) [1656697] - [net] act_sample: get rid of tcf_sample_cleanup_rcu() (Davide Caratti) [1654950] - [net] sched: act_sample: fix NULL dereference in the data path (Davide Caratti) [1654950] - [net] Make NETDEV_XXX commands enum { } (Ivan Vecera) [1654965]- [scsi] csiostor: remove flush_scheduled_work() (Arjun Vynipadath) [1660882] - [scsi] lpfc: Update lpfc version to 12.0.0.10 (Dick Kennedy) [1642905] - [scsi] lpfc: Adding ability to reset chip via pci bus reset (Dick Kennedy) [1642905] - [scsi] lpfc: Add log messages to aid in debugging fc4type discovery issues (Dick Kennedy) [1642905] - [scsi] lpfc: Fix discovery failure when PLOGI is defered (Dick Kennedy) [1642905] - [scsi] lpfc: update fault value on successful trunk events (Dick Kennedy) [1642905] - [scsi] lpfc: Correct MDS loopback diagnostics support (Dick Kennedy) [1642905] - [scsi] lpfc: Fix link state reporting for trunking when adapter is offline (Dick Kennedy) [1642905] - [scsi] lpfc: Enable Management features for IF_TYPE=6 (Dick Kennedy) [1658750 1642905] - [scsi] revert "scsi: lpfc: ls_rjt erroneus FLOGIs" (Dick Kennedy) [1642905] - [scsi] lpfc: update driver version to 12.0.0.9 (Dick Kennedy) [1642905] - [scsi] lpfc: Fix dif and first burst use in write commands (Dick Kennedy) [1642905] - [scsi] lpfc: Fix driver release of fw-logging buffers (Dick Kennedy) [1642905] - [scsi] lpfc: Correct topology type reporting on G7 adapters (Dick Kennedy) [1642905] - [scsi] lpfc: Correct code setting non existent bits in sli4 ABORT WQE (Dick Kennedy) [1642905] - [scsi] lpfc: Defer LS_ACC to FLOGI on point to point logins (Dick Kennedy) [1642905] - [scsi] lpfc: ls_rjt erroneus FLOGIs (Dick Kennedy) [1642905] - [scsi] lpfc: rport port swap discovery issue (Dick Kennedy) [1642905] - [scsi] lpfc: Cap NPIV vports to 256 (Dick Kennedy) [1642905] - [scsi] lpfc: Fix kernel Oops due to null pring pointers (Dick Kennedy) [1642905] - [scsi] lpfc: Fix a duplicate 0711 log message number (Dick Kennedy) [1642905] - [scsi] lpfc: Fix discovery failures during port failovers with lots of vports (Dick Kennedy) [1642905] - [scsi] lpfc: refactor mailbox structure context fields (Dick Kennedy) [1642905] - [scsi] lpfc: update manufacturer attribute to reflect Broadcom (Dick Kennedy) [1642905] - [scsi] lpfc: Fix panic when FW-log buffsize is not initialized (Dick Kennedy) [1642905] - [scsi] lpfc: Use dma_zalloc_coherent (Dick Kennedy) [1642905] - [scsi] lpfc: use dma_set_mask_and_coherent (Dick Kennedy) [1642905] - [scsi] lpfc: update driver version to 12.0.0.8 (Dick Kennedy) [1642905] - [scsi] lpfc: add Trunking support (Dick Kennedy) [1642905] - [scsi] lpfc: Implement GID_PT on Nameserver query to support faster failover (Dick Kennedy) [1642905] - [scsi] lpfc: Correct loss of fc4 type on remote port address change (Dick Kennedy) [1642905] - [scsi] lpfc: Fix odd recovery in duplicate FLOGIs in point-to-point (Dick Kennedy) [1642905] - [scsi] lpfc: Correct LCB RJT handling (Dick Kennedy) [1642905] - [scsi] lpfc: fcoe: Fix link down issue after 1000+ link bounces (Dick Kennedy) [1642905] - [scsi] lpfc: Correct errors accessing fw log (Dick Kennedy) [1642905] - [scsi] lpfc: Reset linkxhX U<$ <<<e9c796cef24256bf1b8c857ec14a672d7199c376d9b130310fa9f95f497d2582fda037ab8a067382b2b5497b463e3c6b9f9d8fca9c6332333e3d12b1b57a14de0989ea4819a8183487ff8d84f2878539bf9f159b5b1254022d2baa7576494405c3814bf2c99414e3784007563e925d70f0064fa6eba6ad57edb3bfcc44c99a12af4b8df3fb5d46b92ffcc983b3feb537c21b8265c0d8738504c0e61d99fe8a929ce39339fe8c217ceb5bbd8ee744128778a089b8c7707e0cd8f78859f03f53eb8ccaa3b73f69698d7ace3d4f51a0248ccea0b288da9ef84e3ce1b37786bfeaf39f81b1d12a21e10eea03a971126368d90d79c0888e0c995942ac7788634516795f8ddbf7d5305225bbcc5cafad83db9a348e0fab926f9500bde17cd4ad542f4fba1b50cc56a3c4504f57f5c841522c5962e4cd5d1118d8fa504faf31b89835bb3f09bdb668eb7f0c33696fe10b483cd940897fb8ecc095d3550192a4e9dd9051f4c461d72d7e3823422851bb98725f4c2e28c63d48b4b2ece39e16c1ef115676b23a938c4d2af45d6b262be3244c0241bc8b47db2a53b067de98b7640c4c5e1c86f400178a33b0d6998aaba76e9cfb24f702f0601e6812004e24fe1e84ef5c0ccbe4dc61de02c16fa044a5c0f22bba5b847ae671b260dcec8ce251b1573d00d7691ff312c8697d0e4af8b776ec40a23d2769fe613ad23e7fa3de07862427e9ac205e13bc7004501e157520edd166a30c270e7b1c9b93fa55c7860d434435d3ffdd84335957ea9ddfd001213e9c1bfcea30db15266196f09d2293a6e60f1c2517be1eb17dd0b81a1c93e26e1be2536bcbaf8b4a0c8a674e1c83f284d0638795edb0d5e519f172063f008af5394bd7f8a5bd0573cdd24cf7f649e523b37eb45ca3aed486ba0b66a74ea3717667bc73069219b0921f773faf84aac9102115af63570159b3fae3416edd6e6057e85440ee4b754c8b53efa563127e2190d15fac733d307de6cf253613d641a9c57dbbe820af11336269da4af8c5aa576495f181a72c4c573af7068542bb7beb25ba93064586d0fd441eb50418cbbb7b88bd80ca82c0b9612d1fc3abadcdf7f4744263713693a2cec4392fc09f4e6800f5da95cb5d9412459ef15fe6c364cf6b6767ccc9d5c547764c19f554b305369ace879716d91613777bc95ca3398883c20a04d71d3e8f40cc3a12390b4c30dc27fd8c6d12c04246b92ae9888027258fa27ae475192e9c96674cb2685d161c275497e3a98b3f490f34a17816c4d50ba2ca76cf609f090c5997b3a4e4873afa670170910abfb7b33356e158a2b74410cafdc2dc183ad5571c83eeb64df54d10bf7f7d0eef59a3ee81c26b58f49edf745c0b693b8b829324e75e89c73333af9cb20ea44057f40293b092932a3c2e54ecd82c29355e78b022ad386e639f00bfe8e88fb17b29d3ffb0f286cdfe4c31a178462f39aa6e2bc1d4a8b99273cfe4f174ff078020b93451acbec79ff9fc80c38a3079d27c252edca7b8767eb6a4264ffedfc4874be26185864b820d7d924686cc6c5f28b3a35afeb9b7fc524cedec6ae8f033a82ec52fc927800e691cceb8028cff9cabde131c542b6309fc31b4c2601a8c46520f7f07d37f3db5aed017625c305082b8d28aaa6aa855b8d6b04f72b32aac956002d1155b6a2db59e7dddf207d909f4b4bd17ca74feecabfd033a935c0d3a0584d50a56181da1fca77533157cc1232ea046e6e99e10154b28557639d7d41dc680c58c4eed594732eeb8a222a1e6cfef30ba48bb0bd6d2227ddc54d81c1747ab424470fca6b6a7e747e510b965062b4231c2d1b11bfadd42892cdfd721745b38effd6ad007c644dfbaa97b96ebd6ba24661b067ed2b68a433870c95ba920b6ebba4507566cf5ad5b6d75e30d62d4eda45c87463e7ad2a6de3ee3f0349071c1fbaa6284f895ae15133a16324722133898f54934b72efe40d6faa62bcab42791a559686d53b91de259af804b93d8af0fa0f22d88a322e363dfadd080a84721a8643e84a72a227a267a117811e18e9602e83dd7ec871f235261e0d2e769ff6e65bf17d0fb04cfc70641e2b63e4f2b36d95298f5869afeb9959412a7147e845be34e7b4e7c17ed876eb97f538b54caa01a3ee007626afbd2079dce99b9b4b3c6d0fccf25503336a33b5e33ac144a5cf21ade2a51c6b99041ae2b90306cdfc1631dd80c368179daefb23e9edd1440036bc4b2e6f2e779d51a8abfeda5e65a3bb8c8abb836ab2276b9d0e8d71e9754ef4ef5ef83a05d1949a8645461de82b2d459e7e7c4ae61c14cc1b75ad840afda00e53a9512fd2a533fc8355dd896fb0c8fbd60d4b79fbf70fd455cbdec4d017a94ea18efb2888906743a258c514a53d0cbf59259a3b9cfdcc6e0d71d376008d7d0bd7c38f6edbc8a254e1f7f0d697abcc257073319eee371ba1e991f0a18a8f0c0c139499b3f201993b5b9df45b5198a458f12e0380a93cf6737fa42f1d4402d2def19e6cae82b2112408a6df850357776453a82d3187fdefb495022c4ec0441a8ff5f0b649c241c843d0993d16a671ca9ee66e4ffa1ee9483ae35ee5f0e1c7aa4d9280a86af8132e3f4aac751bece1d45b817324aaa7f8f437e8f3b4dd47666a298d84098a354481df8abb2d384ca0236ffc8ac5dc5f849d2d5e276ec9d593415abb14e265663576164290f2093ef4369eb3986f94f52d13c615503bff9c5c2e5791649f4a21cb4eaf0c8fa4139a951366feaa7f8407e4fb7a3bdd2d803ae0ab9da79191a589289ed83daab7b138fcf578b3c9530cedf3b6affcf8054df6ab4b4e212a87ee802275dd10aed213x0XX!iW 0)u$luuB0?,Xd   S1 ]o  $ h 9 L:X '( R8 \Y9 Y:YG&H&I',X'@Y'D\'T]'^(b)d)e)f)l)t)u*v*\w+px+y+,T,h,l. . 0000g0h0Cintltool0.50.27.el7Utility for internationalizing various kinds of data filesThis tool automatically extracts translatable strings from oaf, glade, bonobo ui, nautilus theme, .desktop, and other data files and puts them in the po files.Y c1bm.rdu2.centos.orgzCentOSGPLv2 with exceptionsCentOS BuildSystem Development/Toolshttps://launchpad.net/intltoollinuxnoarchp=|!,/FH!H큤A큤A큤Y Y Y Y Y Y Y NNNY Y Y Y Y Y Y 9fc3a77a8397c40afed87b29742e710ae5b29a028533ce688af7e2b55a71d3e7ee6694f40e134a74633ea975b0565c27cc101208a9e86ff583a464af03ec484980b49ee84d1fedd5e7f60f4bff8d8d7b5649952febfc2dd55c9400d6bc1d4bd8bd05e4460e174b74d45458982aef2409db387362ac618869415e5bd5c41eba0931da8b50866373e5f18eb1e4ad8dcc0472315f1e6abafaa6b96b319df5d80df45eed84e09d0283c442c56fed48734889156389f9d332442bf603059e9b8f71dc249885f2e0c058df74170ba86b2d9723325a1a07642b8ae887dabdd8a94e8eb432b1062f7da84967e7019d01ab805935caa7ab7321a7ced0e30ebe75e5df16706026c9a11ed1a04ea3a83b3f64ebadba8cd719835e0370117be0a35a0383f41268b2893de837399abf0ea777cd5c80b4efdca2f1094eb1349d6374ef87ca95e19771024a1ac047f3ad0bf4af2661be79a4834450d86d5e4afdfceb5316341c0b67ae140e1e1000692a9560fdc8145f13f07ec6a407d20dd7b875c200a975d361b0e5a7d87c00c045c4865db7daed630a8a3b50f49670ea0c9bfdb8fa1e29673e9b9398f8abf9b178d574eac01c130fc5c423d28866b91ee450033792a9dddae94ab0bdde4b9dd732a1072f52e9b501110f5c5c99cd19e56cd1842d51a83e4a95rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootintltool-0.50.2-7.el7.src.rpmintltool@@@@@@@@@@@    /bin/sh/usr/bin/perlautomakegettext-develpatchperl(Cwd)perl(Encode)perl(File::Basename)perl(File::Copy)perl(File::Find)perl(Getopt::Long)perl(Text::Wrap)perl(XML::Parser)perl(bytes)perl(strict)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.3XBRkQPPO[@O~ONxMRKDJJ Ji@I@I?@I@I@H!@H7@H@H@H@Hz@HE2@G­GG@GfdGaFFGFF$@F/F@E{@E(E@Ew@DB@D@DiD`@C@C:@CqB@B%A@AbA@ARA~@@@Q@@,@@ ?I@?7@?'@? >@>.>o=˧@=@=C@=C@ - 0.50.2-7Daniel Mach - 0.50.2-6Matthias Clasen - 0.50.2-5Matthias Clasen - 0.50.2-3Fedora Release Engineering - 0.50.2-3xGX"D`0Y $5 ?|   9 (3X<YD hmQGiBD4+owwRBAC14GIfUfCyEDSIePvEW3SAFUdJBtoQHH/nJKZyQT7h9bPlUWC3 RODjQReyCITRrdwyrKUGku2FmeVGwn2u2WmDMNABLnpprWPkBdCk96+OmSLN9brZ fw2vOUgCmYv2hW0hyDHuvYlQA/BThQoADgj8AW6/0Lo7V1W9/8VuHP0gQwCgvzV3 BqOxRznNCRCRxAuAuVztHRcEAJooQK1+iSiunZMYD1WufeXfshc57S/+yeJkegNW hxwR9pRWVArNYJdDRT+rf2RUe3vpquKNQU/hnEIUHJRQqYHo8gTxvxXNQc7fJYLV K2HtkrPbP72vwsEKMYhhr0eKCbtLGfls9krjJ6sBgACyP/Vb7hiPwxh6rDZ7ITnE kYpXBACmWpP8NJTkamEnPCia2ZoOHODANwpUkP43I7jsDmgtobZX9qnrAXw+uNDI QJEXM6FSbi0LLtZciNlYsafwAPEOMDKpMqAK6IyisNtPvaLd8lH0bPAnWqcyefep rv0sxxqUEMcM3o7wwgfN83POkDasDbs3pjwPhxvhz6//62zQJ7Q2TXlTUUwgUmVs ZWFzZSBFbmdpbmVlcmluZyA8bXlzcWwtYnVpbGRAb3NzLm9yYWNsZS5jb20+iGYE ExECACYCGyMGCwkIBwMCBBUCCAMEFgIDAQIeAQIXgAUCTnc+KgUJE/sCFQAKCRCM cY07UHLh9SbMAJ4l1+qBz2BZNSGCZwwA6YbhGPC7FwCgp8z5TzIw4YQuL5NGJ/sy 0oSazqmJASIEEAECAAwFAk53QS4FAwASdQAACgkQlxC4m8pXrXwJ8Qf/be/UO9mq foc2sMyhwMpN4/fdBWwfLkA12FXQDOQMvwH9HsmEjnfUgYKXschZRi+DuHXe1P7l 8G2aQLubhBsQf9ejKvRFTzuWMQkdIq+6Koulxv6ofkCcv3d1xtO2W7nb5yxcpVBP rRfGFGebJvZa58DymCNgyGtAU6AOz4veavNmI2+GIDQsY66+tYDvZ+CxwzdYu+HD V9HmrJfc6deM0mnBn7SRjqzxJPgoTQhihTav6q/R5/2p5NvQ/H84OgS6GjosfGc2 duUDzCP/kheMRKfzuyKCOHQPtJuIj8++gfpHtEU7IDUX1So3c9n0PdpeBvclsDbp RnCNxQWU4mBot7kCDQQ+PqMdEAgA7+GJfxbMdY4wslPnjH9rF4N2qfWsEN/lxaZo JYc3a6M02WCnHl6ahT2/tBK2w1QI4YFteR47gCvtgb6O1JHffOo2HfLmRDRiRjd1 DTCHqeyX7CHhcghj/dNRlW2Z0l5QFEcmV9U0Vhp3aFfWC4Ujfs3LU+hkAWzE7zaD 5cH9J7yv/6xuZVw411x0h4UqsTcWMu0iM1BzELqX1DY7LwoPEb/O9Rkbf4fmLe11 EzIaCa4PqARXQZc4dhSinMt6K3X4BrRsKTfozBu74F47D8Ilbf5vSYHbuE5p/1oI Dznkg/p8kW+3FxuWrycciqFTcNz215yyX39LXFnlLzKUb/F5GwADBQf+Lwqqa8CG rRfsOAJxim63CHfty5mUc5rUSnTslGYEIOCR1BeQauyPZbPDsDD9MZ1ZaSafanFv wFG6Llx9xkU7tzq+vKLoWkm4u5xf3vn55VjnSd1aQ9eQnUcXiL4cnBGoTbOWI39E cyzgslzBdC++MPjcQTcA7p6JUVsP6oAB3FQWg54tuUo0Ec8bsM8b3Ev42LmuQT5N dKHGwHsXTPtl0klk4bQk4OajHsiy1BMahpT27jWjJlMiJc+IWJ0mghkKHt926s/y mfdf5HkdQ1cyvsz5tryVI3Fx78XeSYfQvuuwqp2H139pXGEkg0n6KdUOetdZWhe7 0YGNPw1yjWJT1IhUBBgRAgAMBQJOdz3tBQkT+wG4ABIHZUdQRwABAQkQjHGNO1By 4fUUmwCbBYr2+bBEn/L2BOcnw9Z/QFWuhRMAoKVgCFm5fadQ3Afi+UQlAcOphrnJ gpg-pubkey5072e1f54e773e2agpg(MySQL Release Engineering )-----BEGIN PGP PUBLIC KEY BLOCK----- Version: rpm-4.11.3 (NSS-3) mQGiBD4+owwRBAC14GIfUfCyEDSIePvEW3SAFUdJBtoQHH/nJKZyQT7h9bPlUWC3 RODjQReyCITRrdwyrKUGku2FmeVGwn2u2WmDMNABLnpprWPkBdCk96+OmSLN9brZ fw2vOUgCmYv2hW0hyDHuvYlQA/BThQoADgj8AW6/0Lo7V1W9/8VuHP0gQwCgvzV3 BqOxRznNCRCRxAuAuVztHRcEAJooQK1+iSiunZMYD1WufeXfshc57S/+yeJkegNW hxwR9pRWVArNYJdDRT+rf2RUe3vpquKNQU/hnEIUHJRQqYHo8gTxvxXNQc7fJYLV K2HtkrPbP72vwsEKMYhhr0eKCbtLGfls9krjJ6sBgACyP/Vb7hiPwxh6rDZ7ITnE kYpXBACmWpP8NJTkamEnPCia2ZoOHODANwpUkP43I7jsDmgtobZX9qnrAXw+uNDI QJEXM6FSbi0LLtZciNlYsafwAPEOMDKpMqAK6IyisNtPvaLd8lH0bPAnWqcyefep rv0sxxqUEMcM3o7wwgfN83POkDasDbs3pjwPhxvhz6//62zQJ7Q2TXlTUUwgUmVs ZWFzZSBFbmdpbmVlcmluZyA8bXlzcWwtYnVpbGRAb3NzLm9yYWNsZS5jb20+iGYE ExECACYCGyMGCwkIBwMCBBUCCAMEFgIDAQIeAQIXgAUCTnc+KgUJE/sCFQAKCRCM cY07UHLh9SbMAJ4l1+qBz2BZNSGCZwwA6YbhGPC7FwCgp8z5TzIw4YQuL5NGJ/sy 0oSazqmJASIEEAECAAwFAk53QS4FAwASdQAACgkQlxC4m8pXrXwJ8Qf/be/UO9mq foc2sMyhwMpN4/fdBWwfLkA12FXQDOQMvwH9HsmEjnfUgYKXschZRi+DuHXe1P7l 8G2aQLubhBsQf9ejKvRFTzuWMQkdIq+6Koulxv6ofkCcv3d1xtO2W7nb5yxcpVBP rRfGFGebJvZa58DymCNgyGtAU6AOz4veavNmI2+GIDQsY66+tYDvZ+CxwzdYu+HD V9HmrJfc6deM0mnBn7SRjqzxJPgoTQhihTav6q/R5/2p5NvQ/H84OgS6GjosfGc2 duUDzCP/kheMRKfzuyKCOHQPtJuIj8++gfpHtEU7IDUX1So3c9n0PdpeBvclsDbp RnCNxQWU4mBot7kCDQQ+PqMdEAgA7+GJfxbMdY4wslPnjH9rF4N2qfWsEN/lxaZo JYc3a6M02WCnHl6ahT2/tBK2w1QI4YFteR47gCvtgb6O1JHffOo2HfLmRDRiRjd1 DTCHqeyX7CHhcghj/dNRlW2Z0l5QFEcmV9U0Vhp3aFfWC4Ujfs3LU+hkAWzE7zaD 5cH9J7yv/6xuZVw411x0h4UqsTcWMu0iM1BzELqX1DY7LwoPEb/O9Rkbf4fmLe11 EzIaCa4PqARXQZc4dhSinMt6K3X4BrRsKTfozBu74F47D8Ilbf5vSYHbuE5p/1oI Dznkg/p8kW+3FxuWrycciqFTcNz215yyX39LXFnlLzKUb/F5GwADBQf+Lwqqx 7X#Vp[a$K[aZa\a(:lang=mg)font(:lang=mh)font(:lang=mk)font(:lang=mn-mn)font(:lang=mo)font(:lang=ms)font(:lang=mt)font(:lang=na)font(:lang=nb)font(:lang=nds)font(:lang=ng)font(:lang=nl)font(:lang=nn)font(:lang=no)font(:lang=nr)font(:lang=nso)font(:lang=ny)font(:lang=oc)font(:lang=om)font(:lang=os)font(:lang=pap-an)font(:lang=pap-aw)font(:lang=pl)font(:lang=pt)font(:lang=rm)font(:lang=rn)font(:lang=ro)font(:lang=ru)font(:lang=rw)font(:lang=sc)font(:lang=se)font(:lang=sel)font(:lang=sg)font(:lang=sh)font(:lang=sk)font(:lang=sl)font(:lang=sma)font(:lang=smj)font(:lang=smn)font(:lang=sn)font(:lang=so)font(:lang=sq)font(:lang=sr)font(:lang=ss)font(:lang=st)font(:lang=su)font(:lang=sv)font(:lang=sw)font(:lang=tg)font(:lang=tk)font(:lang=tl)font(:lang=tn)font(:lang=tr)font(:lang=ts)font(:lang=tt)font(:lang=tyv)font(:lang=uk)font(:lang=uz)font(:lang=vo)font(:lang=vot)font(:lang=wa)font(:lang=wen)font(:lang=wo)font(:lang=xh)font(:lang=yap)font(:lang=za)font(:lang=zu)font(z003)urw-base35-z003-fonts     /bin/sh/bin/sh/bin/shfontconfigfontconfigrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)urw-base35-fonts-commonxorg-x11-font-utilsxorg-x11-font-utilsxorg-x11-server-utilsxorg-x11-server-utilsrpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-120170801-10.el75.2-14.11.3['Za@ZZ_@Z@Z}@ZWQZ1@YY@Y5GDavid Kaspar [Dee'Kej] - 20170801-10David Kaspar [Dee'Kej] - 20170801-9David Kaspar [Dee'Kej] - 20170801-8David Kaspar [Dee'Kej] - 20170801-7David Kaspar [Dee'Kej] - 20170801-6Fedora Release Engineering - 20170801-5David Kaspar [Dee'Kej] - 20170801-4David Kaspar [Dee'Kej] 20170801-3David Kaspar [Dee'Kej] - 20170801-2David Kaspar [Dee'Kej] - 20170801-1David Kaspar [Dee'Kej] - 20160926-1- fc-cache call dropped (from scriptlets)- *-legacy subpackage introduced (temporary workaround for BZ #1551219)- copy-paste error fixed in de.urwpp.URWCoreFontSetLevel2.metainfo.xml file- added %check section for validation of AppStream files- temporary workaround for BZ #1534206- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- added missing Obsoletes/Provides for *-nimbus-sans-narrow subpackage- *-devel subpackage added - typos & syntax fixed for AppStream files - NimbusSansNarrow-BdOblique.* renamed to *-BoldOblique - *-nimbus-sans-narrow subpackage dropped - priority/ordering decreased [60->61] - ship *.otf format files as well- urw-base35-fonts-20170801-000-split-urw-fallback.patch added - decrease the fontconfig priority/ordering value to 60 (bug #1494850) - set same priority value for urw-fallback.conf as for other files (bug #1495199)- rebase to 20170801 version - removed urw-* string from subpackages - fontconfig priority value updated to 35 - error messages from 'xset fp rehash' suppressed (bug #1466254) - AppStream files added into (sub)packages - fontconfig files added into (sub)packages - fixed fonts path during %install - source location updated to point at github.com- %description line in 'fontfamily_subpkg' macro split - requirement for 'fontpackages-filesystem' added - mark 'font.dir' and 'font.scale' as %ghost files - fix the upgrading process (for Obsoletes|Provides|Conflicts) - simplify creation of the subpackages with auxiliary %fontfamily_subpkg macro - update the fontconfig cache and X11 Logical Font Description database (during install/update/erase) - initial version of specfile created/bin/sh/bin/shx&X$O`h@o$@  d?     L P \ ` g   ( X Y   0 \h `mQGiBEJny1wRBACRnbQgZ6qLmJSuGvi/EwrRL6aW610BbdpLQRL3dnwy5wI5t9T3 /JEiEJ7GTvAwfiisEHifMfk2sRlWRf2EDQFttHyrrYXfY5L6UAF2IxixK5FL7PWA /2a7tkw1IbCbt4IGG0aZJ6/xgQejrOLi4ewniqWuXCc+tLuWBZrGpE2QfwCggZ+L 0e6KPTHMP97T4xV81e3Ba5MD/3NwOQh0pVvZlW66Em8IJnBgM+eQh7pl4xq7nVOh dEMJwVU0wDRKkXqQVghOxALOSAMapj5mDppEDzGLZHZNSRcvGEs2iPwo9vmY+Qhp AyEBzE4blNR8pwPtAwL0W3cBKUx7ZhqmHr2FbNGYNO/hP4tO2ochCn5CxSwAfN1B Qs5pBACOkTZMNC7CLsSUT5P4+64t04x/STlAFczEBcJBLF1T16oItDITJmAsPxbY iee6JRfXmZKqmDP04fRdboWMcRjfDfCciSdIeGqP7vMcO25bDZB6x6++fOcmQpyD 1Fag3ZUq2yojgXWqVrgFHs/HB3QE7UQkykNp1fjQGbKK+5mWTrQkUmVtaSBDb2xs ZXQgPFJQTVNARmFtaWxsZUNvbGxldC5jb20+iGAEExECACAFAkZ+MYoCGwMGCwkI BwMCBBUCCAMEFgIDAQIeAQIXgAAKCRAATm9HAPl/Vv/UAJ9EL8ioMTsz/2EPbNuQ MP5Xx/qPLACeK5rk2hb8VFubnEsbVxnxfxatGZ25AQ0EQmfLXRAEANwGvY+mIZzj C1L5Nm2LbSGZNTN3NMbPFoqlMfmym8XFDXbdqjAHutGYEZH/PxRI6GC8YW5YK4E0 HoBAH0b0F97JQEkKquahCakj0P5mGuH6Q8gDOfi6pHimnsSAGf+D+6ZwAn8bHnAa o+HVmEITYi6s+Csrs+saYUcjhu9zhyBfAAMFA/9Rmfj9/URdHfD1u0RXuvFCaeOw CYfH2/nvkx+bAcSIcbVm+tShA66ybdZ/gNnkFQKyGD9O8unSXqiELGcP8pcHTHsv JzdD1k8DhdFNhux/WPRwbo/es6QcpIPa2JPjBCzfOTn9GXVdT4pn5tLG2gHayudK 8Sj1OI2vqGLMQzhxw4hJBBgRAgAJBQJCZ8tdAhsMAAoJEABOb0cA+X9WcSAAn11i gC5ns/82kSprzBOU0BNwUeXZAJ0cvNmY7rvbyiJydyLsSxh/la6HKw== gpg-pubkey00f97f56467e318agpg(Remi Collet )-----BEGIN PGP PUBLIC KEY BLOCK----- Version: rpm-4.11.3 (NSS-3) mQGiBEJny1wRBACRnbQgZ6qLmJSuGvi/EwrRL6aW610BbdpLQRL3dnwy5wI5t9T3 /JEiEJ7GTvAwfiisEHifMfk2sRlWRf2EDQFttHyrrYXfY5L6UAF2IxixK5FL7PWA /2a7tkw1IbCbt4IGG0aZJ6/xgQejrOLi4ewniqWuXCc+tLuWBZrGpE2QfwCggZ+L 0e6KPTHMP97T4xV81e3Ba5MD/3NwOQh0pVvZlW66Em8IJnBgM+eQh7pl4xq7nVOh dEMJwVU0wDRKkXqQVghOxALOSAMapj5mDppEDzGLZHZNSRcvGEs2iPwo9vmY+Qhp AyEBzE4blNR8pwPtAwL0W3cBKUx7ZhqmHr2FbNGYNO/hP4tO2ochCn5CxSwAfN1B Qs5pBACOkTZMNC7CLsSUT5P4+64t04x/STlAFczEBcJBLF1T16oItDITJmAsPxbY iee6JRfXmZKqmDP04fRdboWMcRjfDfCciSdIeGqP7vMcO25bDZB6x6++fOcmQpyD 1Fag3ZUq2yojgXWqVrgFHs/HB3QE7UQkykNp1fjQGbKK+5mWTrQkUmVtaSBDb2xs ZXQgPFJQTVNARmFtaWxsZUNvbGxldC5jb20+iGAEExECACAFAkZ+MYoCGwMGCwkI BwMCBBUCCAMEFgIDAQIeAQIXgAAKCRAATm9HAPl/Vv/UAJ9EL8ioMTsz/2EPbNuQ MP5Xx/qPLACeK5rk2hb8VFubnEsbVxnxfxatGZ25AQ0EQmfLXRAEANwGvY+mIZzj C1L5Nm2LbSGZNTN3NMbPFoqlMfmym8XFDXbdqjAHutGYEZH/PxRI6GC8YW5YK4E0 HoBAH0b0F97JQEkKquahCakj0P5mGuH6Q8gDOfi6pHimnsSAGf+D+6ZwAn8bHnAa o+HVmEITYi6s+Csrs+saYUcjhu9zhyBfAAMFA/9Rmfj9/URdHfD1u0RXuvFCaeOw CYfH2/nvkx+bAcSIcbVm+tShA66ybdZ/gNnkFQKyGD9O8unSXqiELGcP8pcHTHsv JzdD1k8DhdFNhux/WPRwbo/es6QcpIPa2JPjBCzfOTn9GXVdT4pn5tLG2gHayudK 8Sj1OI2vqGLMQzhxw4hJBBgRAgAJBQJCZ8tdAhsMAAoJEABOb0cA+X9WcSAAn11i gC5ns/82kSprzBOU0BNwUeXZAJ0cvNmY7rvbyiJydyLsSxh/la6HKw== =6Rbg -----END PGP PUBLIC KEY BLOCK----- F~1localhostpubkeyRemi Collet Public Keys(none)gpg(Remi Collet )gpg(00f97f56)4.11.34:004e6f4700f97f56-467e318a4:004e6f4700f97f56-467e318a?cd1fc24b8ab1b1eec4021a4e5828eddd4554adb0bb>@>h>Z @>R @>;>.> @>@>{@=z@=>==E@=4 =2@= =@<@<<<@<@@ - 2:2.10.1-9Jaroslav Škarvada - 2:2.10.1-8Jaroslav Škarvada - 2:2.10.1-7Daniel Mach - 2:2.10.1-6Honza Horak - 2:2.10.1-5Jaroslav Škarvada - 2:2.10.1-4Daniel Mach - 2:2.10.1-3Jaroslav Škarvada - 2:2.10.1-2Jaroslav Škarvada - 2:2.10.1-1Jaroslav Škarvada - 2:2.10.0-2Jaroslav Škarvada - 2:2.10.0-1Jaroslav Škarvada - 2:2.10.0-0.3.rc1Jaroslav Škarvada - 2:2.10xX%W (($8()bnses//opt/remi/php56/root/usr/share/licenses/php56-php-ioncube-loader-13.0.4/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, strippeddirectory PR RRRRRRPR PR PR PR PR https://forum.remirepo.net/?p/<!qq]hu 3]!LΈJ]NoGVfYG NoGVXVm9c$Hi)Vc)ZRL ^Lj]!LΈJ]NoGVfYG NoGV!}/-uv>_Ӛ`HVxbd5ef62aaec43c7151213d04fe2fbf07e926b7b4g v,g uix ceph_msg_revoke() (Ilya Dryomov) [1344930] - [fs] libceph: use list_for_each_entry_safe (Ilya Dryomov) [1344930] - [fs] ceph: use i_size_{read, write} to get/set i_size (Ilya Dryomov) [1344930] - [fs] ceph: re-send AIO write request when getting -EOLDSNAP error (Ilya Dryomov) [1344930] - [fs] ceph: Asynchronous IO support (Ilya Dryomov) [1344930] - [fs] ceph: Avoid to propagate the invalid page point (Ilya Dryomov) [1344930] - [fs] ceph: fix double page_unlock() in page_mkwrite() (Ilya Dryomov) [1344930] - [fs] rbd: delete an unnecessary check before rbd_dev_destroy() (Ilya Dryomov) [1344930] - [fs] libceph: use list_next_entry instead of list_entry_next (Ilya Dryomov) [1344930] - [fs] ceph: ceph_frag_contains_value can be boolean (Ilya Dryomov) [1344930] - [fs] ceph: remove unused functions in ceph_frag.h (Ilya Dryomov) [1344930] - [fs] rbd: don't put snap_context twice in rbd_queue_workfn() (Ilya Dryomov) [1344930] - [fs] libceph: clear msg->con in ceph_msg_release() only (Ilya Dryomov) [1344930] - [fs] libceph: add nocephx_sign_messages option (Ilya Dryomov) [1344930] - [fs] libceph: stop duplicating client fields in messenger (Ilya Dryomov) [1344930] - [fs] libceph: drop authorizer check from cephx msg signing routines (Ilya Dryomov) [1344930] - [fs] libceph: msg signing callouts don't need con argument (Ilya Dryomov) [1344930] - [fs] libceph: evaluate osd_req_op_data() arguments only once (Ilya Dryomov) [1344930] - [fs] libceph: introduce ceph_x_authorizer_cleanup() (Ilya Dryomov) [1344930] - [fs] rbd: remove duplicate calls to rbd_dev_mapping_clear() (Ilya Dryomov) [1344930] - [fs] rbd: set device_type::release instead of device::release (Ilya Dryomov) [1344930] - [fs] rbd: don't free rbd_dev outside of the release callback (Ilya Dryomov) [1344930] - [fs] rbd: return -ENOMEM instead of pool id if rbd_dev_create() fails (Ilya Dryomov) [1344930] - [fs] libceph: use local variable cursor instead of &msg->cursor (Ilya Dryomov) [1344930] - [fs] libceph: remove con argument in handle_reply() (Ilya Dryomov) [1344930] - [fs] ceph: combine as many iovec as possile into one OSD request (Ilya Dryomov) [1344930] - [fs] rbd: drop null test before destroy functions (Ilya Dryomov) [1344930] - [fs] rbd: require stable pages if message data CRCs are enabled (Ilya Dryomov) [1344930] - [fs] rbd: prevent kernel stack blow up on rbd map (Ilya Dryomov) [1344930] - [fs] rbd: don't leak parent_spec in rbd_dev_probe_parent() (Ilya Dryomov) [1344930] - [fs] rbd: use writefull op for object size writes (Ilya Dryomov) [1344930] - [fs] rbd: set max_sectors explicitly (Ilya Dryomov) [1344930] - [fs] libceph: advertise support for keepalive2 (Ilya Dryomov) [1344930] - [fs] libceph: don't access invalid memory in keepalive2 path (Ilya Dryomov) [1344930] - [fs] libceph: check data_len in ->alloc_msg() (Ilya Dryomov) [1344930] - [fs] libceph: use keepalive2 to verify the mon session is alive (Ilya Dryomov) [1344930] - [fs] rbd: plug rbd_dev->header.object_prefix memory leak (Ilya Dryomov) [1344930] - [fs] rbd: fix double free on rbd_dev->header_name (Ilya Dryomov) [1344930] - [fs] libceph: set 'exists' flag for newly up osd (Ilya Dryomov) [1344930] - [fs] libceph: renamexX&WH $iibrary version 21.3- fix intl build on F35- Fix #81211 Symlinks are followed when creating PHAR archive- Fix #81122 SSRF bypass in FILTER_VALIDATE_URL CVE-2021-21705 - Fix #65689 PDO_Firebrid / exec() does not free allocated statement - Fix #76488 Memory leak when fetching a BLOB field - Fix #76448 Stack buffer overflow in firebird_info_cb - Fix #76449 SIGSEGV in firebird_handle_doer - Fix #76450 SIGSEGV in firebird_stmt_execute - Fix #76452 Crash while parsing blob data in firebird_fetch_blob CVE-2021-21704- fix snmp extension build with net-snmp without DES- Fix #80710 imap_mail_compose() header injection - use oracle client library version 21.1- Fix #80672 Null Dereference in SoapClient CVE-2021-21702 - better fix for #77423- Fix #77423 FILTER_VALIDATE_URL accepts URLs with invalid userinfo CVE-2020-7071- Core: Fix #79699 PHP parses encoded cookie names so malicious `__Host-` cookies can be sent CVE-2020-7070- Core: Fix #79877 getimagesize function silently truncates after a null byte - Phar: Fix #79797 use of freed hash key in the phar_parse_zipfile function CVE-2020-7068- Core: Fix #78875 Long filenames cause OOM and temp files are not cleaned CVE-2019-11048 Fix #78876 Long variables in multipart/form-data cause OOM and temp files are not cleaned- standard: Fix #79330 shell_exec silently truncates after a null byte Fix #79465 OOB Read in urldecode CVE-2020-7067- standard: Fix #79329 get_headers() silently truncates after a null byte CVE-2020-7066 - exif: Fix #79282 Use-of-uninitialized-value in exif CVE-2020-7064 - use oracle client library version 19.6 (18.5 on EL-6)- add fix for GCC 10- phar: Fix #79082 Files added to tar with Phar::buildFromIterator have all-access permissions CVE-2020-7063 - session: Fix #79221 Null Pointer Dereference in PHP Session Upload Progress CVE-2020-7062- mbstring: Fix #79037 global buffer-overflow in mbfl_filt_conv_big5_wchar CVE-2020-7060 - standard: Fix #79099 OOB read in php_strip_tags_ex CVE-2020-7059- bcmath: Fix #78878 Buffer underflow in bc_shift_addsub CVE-2019-11046 - core: Fix #78862 link() silently truncates after a null byte on Windows CVE-2019-11044 Fix #78863 DirectoryIterator class silently truncates after a null byte CVE-2019-11045 - exif Fix #78793 Use-after-free in exif parsing under memory sanitizer CVE-2019-11050 Fix #78910 Heap-buffer-overflow READ in exif CVE-2019-11047 - use oracle client library version 19.5 (18.5 on EL-6)- FPM: Fix CVE-2019-11043 env_path_info underflow in fpm_main.c- mbstring: Fix CVE-2019-13224 don't allow different encodings for onig_new_deluxe - pcre: Fix #75457 heap use-after-free in pcrelib- exif: Fix #78256 heap-buffer-overflow on exif_process_user_comment CVE-2019-11042 Fix #78222 heap-buffer-overflow on exif_scan_thumbnail CVE-2019-11041 - phar: Fix #77919 Potential UAF in Phar RSHUTDOWN- use oracle client library version 19.3- iconv: Fix #78069 Out-of-bounds read in iconv.c:_php_iconv_mime_decode() CVE-2019-11039 - exif: Fix #77988 Heap-buffer-overflow on php_jpg_get16 CVE-2019-11040 - sqlite3: Fix #77967 Bypassing open_basedir restrictions via file uris- exif: Fix #77950 Heap-buffer-overflow in _estrndup via exif_process_IFD_TAG CVE-2019-11036- exif: Fix #77753 Heap-buffer-overflow in php_ifd_get32s CVE-2019-11034 Fix #77831 Heap-buffer-overflow in exif_iif_add_value CVE-2019-11035 - sqlite3: Added sqlite3.defensive INI directive- Fix #76846 Segfault in shutdown function after memory limit error- phar: Fix #77396 Null Pointer Dereference in phar_create_or_parse_filename Fix #77586 - phar_tar_writeheaders_int() buffer overflow - spl: Fix #77431 openFile() silently truncates after a null byte - security fix synced with https://github.com/Microsoft/php-src/- Fix #77630 rename() across the device may allow unwanted access during processing CVE-2019-9637- exif: Fix #77509 Uninitialized read in exif_process_IFD_in_TIFF CVE-2019-9641 Fix #77540 Invalid Read oxX'Vs` j$Mjjjrch=z196 instead of -march=z10 on s390/s390x (#1052890)- define %global _performance_build 1 (#1051064)- treat ppc64p7 as ppc64 (#1048859)- update from the 4.8 branch - PRs libgomp/59467, rtl-optimization/58295, target/56807, testsuite/59442 - fix LRA coalescing for real (PR middle-end/59470)- temporarily revert PR middle-end/58956 to avoid libstdc++ miscompilation on i?86 (PR middle-end/59470)- update from the 4.8 branch - PRs ada/59382, bootstrap/57683, c++/58162, c++/59031, c++/59032, c++/59044, c++/59052, c++/59268, c++/59297, c/59280, c/59351, fortran/57445, fortran/58099, fortran/58471, fortran/58771, middle-end/58742, middle-end/58941, middle-end/58956, middle-end/59011, middle-end/59037, middle-end/59138, rtl-optimization/58726, target/50751, target/51244, target/56788, target/58854, target/58864, target/59021, target/59088, target/59101, target/59153, target/59163, target/59207, target/59343, target/59405, tree-optimization/57517, tree-optimization/58137, tree-optimization/58143, tree-optimization/58653, tree-optimization/58794, tree-optimization/59014, tree-optimization/59047, tree-optimization/59139, tree-optimization/59164, tree-optimization/59288, tree-optimization/59330, tree-optimization/59334, tree-optimization/59358, tree-optimization/59388 - aarch64 gcj enablement (#1023789) - look for libgfortran.spec and libitm.spec in %{_lib} rather than lib subdirs (#1023789)- update from the 4.8 branch - PRs plugins/52872, regression/58985, target/59034- update from the 4.8 branch - PRs c++/58282, c++/58979, fortran/58355, fortran/58989, libstdc++/58839, libstdc++/58912, libstdc++/58952, lto/57084, middle-end/58789, rtl-optimization/58079, rtl-optimization/58831, rtl/58542, target/58690, target/58779, target/58792, target/58838, tree-optimization/57488, tree-optimization/58805, tree-optimization/58984 - fix ICEs in get_bit_range (PR middle-end/58970) - fix ICEs in RTL loop unswitching (PR rtl-optimization/58997)- update from the 4.8 branch - PRs c++/58596, libstdc++/58800 - power8 TImode fix (#1014053, PR target/58673)- update from the 4.8 branch - GCC 4.8.2 release - PRs c++/57850, c++/58633, libstdc++/58191- update from the 4.8 branch - PRs c++/58568, fortran/55469, fortran/57697, fortran/58469, libstdc++/57465, libstdc++/57641, libstdc++/58659, target/58460, tree-optimization/58539 - fix asm goto handling (#1017704, PR middle-end/58670)- update from the 4.8 branch - PRs c++/58535, libstdc++/58437, libstdc++/58569, middle-end/56791, middle-end/58463, middle-end/58564, target/58330, tree-optimization/56716 - fix s390x z10+ chunkification (#1012870, PR target/58574) - disable ppc{,64} -mvsx-timode by default (#1014053, PR target/58587)- update from the 4.8 branch - PRs ada/58264, c++/58457, c++/58458, libstdc++/58358, tree-optimization/58088 - on RHEL7, configure on ppc/ppc64 with default -mcpu=power7, on s390/s390x with default -march=z10 -mtune=zEC12 and on i?86 default to -march=x86-64 -mtune=generic (#805157) - on Fedora 20+ and RHEL7 default to -fdiagnostics-color=auto rather than -fdiagnostics-color=never, if GCC_COLORS isn't in the environment; to turn it off by default, set GCC_COLORS= in the environment- update from the 4.8 branch - PRs c++/58273, libstdc++/58415, middle-end/58377, rtl-optimization/58365, target/58314, target/58361, target/58382, tree-optimization/58385 - add arm_neon.h on aarch64 (#1007490)- update from the 4.8 branch - PRs c++/58325, libstdc++/58302, libstdc++/58341, middle-end/57656, other/12081, target/57735, tree-optimization/57521, tree-optimization/57685, tree-optimization/58010, tree-optimization/58223, tree-optimization/58228, tree-optimization/58246, tree-optimization/58277, tree-optimization/58364- update from the 4.8 branch - PRs c++/58083, c++/58119, c++/58190, fortran/57798, fortran/58185, middle-end/56977, middle-end/57381, middle-end/58257, target/56979, target/57865, target/57927, target/58218, tree-optimization/57343, tree-optimization/57396, tree-optixxX(V '$7'&BH?d  G &OU\             B t  @  (@8H9: MG H I XY$\8 ]` ^bdefl!t< ud vw x@ yh  ,0 <g@hDCperl-Digest-HMAC1.035.el7Keyed-Hashing for Message AuthenticationHMAC is used for message integrity checks between two parties that share a secret key, and works in combination with some other Digest algorithm, usually MD5 or SHA-1. The HMAC mechanism is described in RFC 2104. HMAC follow the common Digest:: interface, but the constructor takes the secret key and the name of some other simple Digest:: as argument.Sworker1.bsys.centos.org2CentOSGPL+ or ArtisticCentOS BuildSystem Development/Librarieshttp://search.cpan.org/dist/Digest-HMAC/linuxnoarch  IZA큤A큤SN-I*SSSSN-I*N-30a65bb7f1b4af5a89bccd01cf0dc7fd45dea63c3dff49cbf0b8c329ac9e8c3656bf7cdaec5eebf74d58679638ebef5015883e65c1be7251a3ef8cce8bdd1ff5f82bc5f5f71d2e74ffdd806fdea56a4569d0ea27e706a1500227530ebbc63b57f69f9fcc0d30877d68773c813b4c8ed707cd1a38e3041a0c130acc6497a4094876a64ba3ef3afe2436f09c335b5b971faf198f237f1f8fd715e87559c82ff1d2aab5d1997b7bf39a6ddf08287cbb14a3c935d44b041bd0905604067c543b27dbb311fcb3d47546829182f5c39a1e7567ebbfd5b1c1edeac605a04ed5d37908b18eb45b1af55ea77a06fef3dd9ad59b4a7a6e7e3f61c3fe190e67518d2c90e3c7rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-Digest-HMAC-1.03-5.el7.src.rpmperl(Digest::HMAC)perl(Digest::HMAC_MD5)perl(Digest::HMAC_SHA1)perl-Digest-HMAC@@@@@@    perl(:MODULE_COMPAT_5.16.3)perl(Digest::HMAC)perl(Digest::MD5)perl(Digest::SHA)perl(Exporter)perl(strict)perl(vars)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.1RkP+@P H@O/@ON{#@MMQ0@M @KK@K͗@K@JjI@GPG7G3FҼD@CEC@C@BlAQi@@@>5@=O@=@=Daniel Mach - 1.03-5Daniel Mach - 1.03-4.1Fedora Release Engineering - 1.03-4Petr Pisar - 1.03-3Fedora Release Engineering - 1.03-2Marcela Mašláňová 1.03-1Marcela Mašláňová - 1.02-6Fedora Release Engineering - 1.02-5Marcela Maslanova - 1.02-4Marcela Maslanova - 1.02-3Marcela Maslanova - 1.02-2Petr Pisar - 1.02-1Stepan Kasal - 1.01-22Fedora Release Engineering - 1.01-21Fedora Release Engineering - 1.01-20Tom "spot" Callaway - 1.01-19Tom "spot" Callaway - 1.01-18Robin Norwood - 1.01-17Robin Norwood - 1.01-16Jesse Keating = 5.0.0- bump default memory_limit to 32M (#220821) - mark config files noreplace again (#174251) - drop trailing dots from Summary fields - use standard BuildRoot - drop libtool15 patch (#226294)- add php(api), php(zend-abi) provides (#221302) - package /usr/share/php and append to default include_path (#225434)- fix filter.h installation path - fix php-zend-abi version (Remi Collet, #212804)- rebuild again- rebuild for net-snmp soname bump- build json and zip shared, in -common (Remi Collet, #215966) - obsolete php-json and php-pecl-zip - build readline extension into /usr/bin/php* (#210585) - change module subpackages to require php-common not php (#177821)- provide php-zend-abi (#212804) - add /etc/rpm/macros.php exporting interface versions - synch with upstream recommended php.ini- update to 5.2.0 (#213837) - php-xml provides php-domxml (#215656) - fix php-pdo-abi provide (#214281)- rebuild for curl soname bump - add build fix for curl 7.16 API- from upstream: add safety checks against integer overflow in _ecalloc- update to 5.1.6 (security fixes) - bump default memory_limit to 16M (#196802)- rebuild- Provide php-posix (#194583) - only provide php-pcntl from -cli subpackage - add missing defattr's (thanks to Matthias Saou)- move Obsoletes for php-openssl to -common (#194501) - Provide: php-cgi from -cli subpackage- split out php-cli, php-common subpackages (#177821) - add php-pdo-abi version export (#193202)- rebuilt for new libnetsnmp- provide mod_php (#187891) - provide php-cli (#192196) - use correct LDAP fix (#181518) - define _GNU_SOURCE in php_config.h and leave it defined - drop (circular) dependency on php-pear- update to 5.1.4- update to 5.1.3- provide php-api (#183227) - add provides for all builtin modules (Tim Jackson, #173804) - own %{_libdir}/php/pear for PEAR packages (per #176733) - add obsoletes to allow upgrade from FE4 PDO packages (#181863)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild for new libc-client soname- only build xmlreader and xmlwriter shared (#177810)- update to 5.1.2- rebuild again- rebuild for new net-snmp- enable short_open_tag in default php.ini again (#175381)- rebuilt- require net-snmp for php-snmp (#174800)- add /usr/share/pear back to hard-coded include_path (#174885)- rebuild for httpd 2.2- update to 5.1.1 - remove pear subpackage - enable pdo extensions (php-pdo subpackage) - remove non-standard conditional module builds - enable xmlreader extension- rebuilt against new openssl- pear: update to XML_RPC 1.4.4, XML_Parser 1.2.7, Mail 1.1.9 (#172528)- rebuild for new libnetsnmp- update to 5.0.5 - add fix for upstream #34435 - devel: require autoconf, automake (#159283) - pear: update to HTTP-1.3.6, Mail-1.1.8, Net_SMTP-1.2.7, XML_RPC-1.4.1 - fix imagettftext et al (upstream, #161001)- ldap: restore ldap_start_tls() function- disable RPATHs in shared extensions (#156974)- build simplexml_import_dom even with shared dom (#156434) - prevent truncation of copied files to ~2Mb (#155916) - install /usr/bin/php from CLI build alongside CGI - enable sysvmsg extension (#142988)- prevent build of builtin dba as well as shared extension- split out dba and bcmath extensions into subpackages - BuildRequire gcc-c++ to avoid AC_PROG_CXX{,CPP} failure (#155221) - pear: update to DB-1.7.6 - enable FastCGI support in /usr/bin/php-cgi (#149596)- build /usr/bin/php with the CLI SAPI, and add /usr/bin/php-cgi, built with the CGI SAPI (thanks to Edward Rudd, #137704) - add php(1) man page for CLI - fix more test cases to use -n when invoking php- rebuild for new libpq soname- bundle from PEAR: HTTP, Mail, XML_Parser, Net_Socket, Net_SMTP - snmp: disable MSHUTDOWN function to prevent error_log noise (#153988) - mysqli: add fix for crash on x86_64 (Georg Richter, upstream #32282)- build shared objects as PIC (#xhX*5X`$.m13Balasubramanian Kandasamy - 5.7.3-0.1.m13Balasubramanian Kandasamy - 5.6.15-1Balasubramanian Kandasamy - 5.6.14-3Balasubramanian Kandasamy - 5.6.14-2Balasubramanian Kandasamy - 5.6.14-1Balasubramanian Kandasamy - 5.6.13-5Balasubramanian Kandasamy - 5.6.13-4Balasubramanian Kandasamy - 5.6.13-3Balasubramanian Kandasamy - 5.6.13-2 Balasubramanian Kandasamy - 5.6.13-1Balasubramanian Kandasamy - 5.6.12-9Balasubramanian Kandasamy - 5.6.12-8Balasubramanian Kandasamy - 5.6.12-7Balasubramanian Kandasamy - 5.6.12-6Balasubramanian Kandasamy - 5.6.12-5Balasubramanian Kandasamy - 5.6.12-4Balasubramanian Kandasamy - 5.6.12-3Balasubramanian Kandasamy - 5.6.12-2Balasubramanian Kandasamy - 5.6.12-1Joerg Bruehe Bjorn Munch Joerg Bruehe Joerg Bruehe Joerg Bruehe Joerg Bruehe Brajmohan Saxena Joerg Bruehe Joerg Bruehe Jonathan Perkin Joerg Bruehe Daniel Fischer Tor Didriksen Joerg Bruehe Joerg Bruehe Daniel Fischer Chuck Bell Sunanda Menon Joerg Bruehe Joerg Bruehe Joerg Bruehe Jonathan Perkin Georgi Kodinov Georgi Kodinov Joerg Bruehe Joerg Bruehe Jonathan Perkin Jonathan Perkin Joerg Bruehe Joerg Bruehe Joerg Bruehe Joerg Bruehe Joerg Bruehe Joerg Bruehe Joerg Bruehe Joerg Bruehe Joerg Bruehe Magnus Blaudd Alexander Nozdrin Joerg Bruehe Joerg Bruehe Jonathan Perkin Jonathan Perkin Jonathan Perkin Joerg Bruehe Kent Boortz Joerg Bruehe Kent Boortz Joerg Bruehe Kent Boortz Joerg Bruehe Timothy Smith Joerg Bruehe Kent Boortz Daniel Fischer Daniel Fischer Joerg Bruehe Kent Boortz Joerg Bruehe Joerg Bruehe Joerg Bruehe Joerg Bruehe Joerg Bruehe Joerg Bruehe Kent Boortz Kent Boortz Kent Boortz Kent Boortz Jim Winstead Jim Winstead Kent Boortz Kent Boortz Kent Boortz Kent Boortz ?@G(H<IPXXYl\]^b_defltu(v<wxy 4HLd t ghClibquadmath4.8.544.el7GCC __float128 shared support libraryThis package contains GCC shared support library which is needed for __float128 math support and for Fortran REAL*16 support._sx86-02.bsys.centos.orgPCentOSGPLv3+ and GPLv3+ with exceptions and GPLv2+ with exceptions and LGPLv2+ and BSDCentOS BuildSystem System Environment/Librarieshttp://gcc.gnu.orglinuxx86_64/sbin/ldconfig if [ -f /usr/share/info/libquadmath.info.gz ]; then /sbin/install-info \ --info-dir=/usr/share/info /usr/share/info/libquadmath.info.gz || : fiif [ $1 = 0 -a -f /usr/share/info/libquadmath.info.gz ]; then /sbin/install-info --delete \ --info-dir=/usr/share/info /usr/share/info/libquadmath.info.gz || : figH,A큤_s_s_sPɬR_s96973f995bad4e4b80eaa188b7bac60bd0df44b22ee67bd046b3aa4ecb9e34fd32434afcc8666ba060e111d715bfdb6c2d5dd8a35fa4d3ab8ad67d8f850d2f2b582798419f66267d4386aaae20358536649e5343be4c26a08e440218222c241flibquadmath.so.0.0.0rootrootrootrootrootrootrootrootrootrootgcc-4.8.5-44.el7.src.rpmlibquadmathlibquadmathlibquadmath(x86-64)libquadmath.so.0()(64bit)libquadmath.so.0(QUADMATH_1.0)(64bit) @@@@@@@@   @ /bin/sh/bin/sh/sbin/install-info/sbin/install-info/sbin/ldconfiglibc.so.6()(64bit)libc.so.6(GLIBC_2.10)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.4)(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.3^{G^y@^[]B]6\u*@\s\?[[{@Z@ZmZ؄Z̧@Zľ@Z2@ZaZWQZN@Z ZNYYYB@YY@Y@Yp@Yo@Y0Y.@XƉX•@XWW@W@WaC@WYZ@WUeW1@UK@U'U@UJ@TeT%U@TT=@S@Sہ@S@SǺSh@St@SG@SnS@SRa@RRx@R&RR@R@RSRRRz/@RcR_@RVRL R<8R5@R-@R7R q@Q@Q@QzQbQ@Q@QV@QQ@QQq1Qg@QLGQIQD^Q8@Q4Q$Q#@Q@Q@QQEQ \QQ"@P@P-Pg@Marek Polacek 4.8.5-44Marek Polacek 4.8.5-43Marek Polacek 4.8.5-42Marek Polacek 4.8.5-41Marek Polacek 4.8.5-40Marek Polacek 4.8.5-39Marek Polacek 4.8.5-38Jeff Law 4.8.5-37Marek Polacek 4.8.5-36Marek Polacek 4.8.5-35Marek Polacek 4.8.5-34Jeff Law 4.8.5-33Jeff Law 4.8.5-32Marek Polacek 4.8.5-31Marek Polacek 4.8.5-30Jeff Law 4.8.5-29Marek Polacek 4.8.5-28Marek PolaxXX,W$+ail package - /var/log/mail now belongs to sendmail (#192850)- rebuild- dropped reference to Red Hat Linux in sendmail-redhat.mc (#176679)- new version 8.13.7 (#195282) - fixes CVE-2006-1173 (VU#146718): possible denial of service issue caused by malformed multipart messages (#195776)- new version 8.13.6 (fixes VU#834865) - dropped libmilter-sigwait patch (fixed in 8.13.6)- fixed selinuxenabled path in initscript - fixed error handling with sigwait (#137709) Thanks to Jonathan Kamens for the patch - fixed prereq for cyrus-sasl: now using /usr/sbin/saslauthd - appended 'dnl' to cert tags in sendmail.mc- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- rebuilt against new openssl- use include instead of pam_stack in pam config- new version 8.13.5 - fixed email address in changelog- using new certificates directory /etc/pki/tls/certs- added configuration example for Cyrus-IMAPd to sendmail.mc (#142001) Thanks to Alexander Dalloz- new version 8.13.4 - added requires for the sendmail base package in sendmail-cf, sendmail-devel and sendmail-doc - dropped upstream close_wait.p2 patch- dropped direct support for bind: no bind in confLIBSEARCH anymore, using libresolv again- fix libbind include path - use /usr/include/bind/netdb.h, no - /usr/include/netdb.h - bug: 150339- fixed gcc4 build: use double quotes for confOPTIMIZE to avoid m4 confusion with ',' - fix for ppc: using tripple-quotes- new version 8.13.3 with closewait.p2 patch- new version 8.13.2 - thanks to Robert Scheck for adapting the patches- rebuild against db-4.3.21.- added missing BuildRequires for groff (#134778) - added socketmap support (#131906)- applied Sendmail Errata (2004-08-24): errata_cataddr (#131179)- new version 1.13.1- fixed init script to not complain missing sendmail-cf package (#126975) - better message in /etc/mail/Makefile for missing sendmail-cf package.- new version 8.13.0 - made /etc/mail/Makefile complain missing sendmail-cf package (#123348) - fixed ownership of %{_includedir}/libmilter (#73977) - moved back to /usr/share/ssl/certs as certificate directory (see sendmail.mc) - extended sendmail.mc for spam protection- rebuilt- Fix selinuxenabled location- Fix security context of pid file for selinux- fixed alternatives slave for sendmail.sendmail- set path to cyrus-imapd deliver- fixed spec file- added authinfo to possible sendmail maps: /etc/mail/Makefile (#119010) - fixed minor version in changelog- new slave in alternatives for sendmail man page- rebuilt- removed buildreq for gdbm-devel- RH3.0E version: sasl1, no pie, old_setup (provide /etc/aliases) - new switches for pie and old_setup- new Sendmail.conf for sasl1 (#114726)- added information for saslauthd and AUTH (#113463) - fixed STATUS_FILE in sendmail-redhat.mc (#114302) - reset mta after update if mta was sendmail (#114257) - enabled pie for ia64 again- removed /etc/aliases (now in setup)- /usr/lib/sendmail is in alternatives, now - removed trailing / from stdir - fixed define for STATUS_FILE- disabled pie for ia64- new version 8.12.11 - pie- fc2 version (with sasl2)- reverted to sasl1 for 3.0E: added with_sasl1 - spec file cleanup - new location for statistics file (/var/log/)- Fix download url.- rebuild against db-4.2.52.- fix pam alternatives handling - add patch from Jakub Jelinek for PIE- fix usage of RPM_OPT_FLAGS variable in spec file - add makecert.sh script to -doc subpackage - add cert paths to sendmail.mc- fix alternatives (#109313) - enable TLS- add some more system account entries into /etc/aliases - add example for a mixed IPv6/IPv4 setup- added with_ options- rebuild against db-4.2.42.- update to 8.12.10- add security patches for CAN-2003-0694 and CAN-2003-0681- move debug information from sendmail into debuginfo rpm - on %post make sure /etc/aliases.db and /etc/mail/*.db is correctly owned by root - do not set confTRUSTED_USER to smmsp in sendmail-redhat.mc- run "make -C /etc/mail" (maybe generating new sendmail.cf, thenxБX-Wh$ug 66060 - fix fix overflow handling bug in non-x86- test build- test build- test build for https://bugs.php.net/66218 zend_register_functions breaks reflection- test build of 5.5.7RC1- update to 5.5.6- update to 5.5.6, test build- add --with debug option for debug build- test buid with opcache changes reverted- test build opcache with phar build shared https://github.com/zendtech/ZendOptimizerPlus/issues/147- build phar shared, opcache loaded with RTLD_LAZY- build phar static for opcache dep.- test build of 5.5.6RC1- rebuild using libicu-last 50.1.2- update to 5.5.5- test build- update to 5.5.4 - improve security, use specific soap.wsdl_cache_dir use /var/lib/php/wsdlcache for mod_php and php-fpm - sync short_tag comments in php.ini with upstream- test build with -fsanitize=address - test build for https://bugs.php.net/65564- update to 5.5.3 - build without zip extension, requires php-pecl-zip - fix typo and add missing entries in php.ini- update to 5.5.3 - test build without zip extension - fix typo and add missing entries in php.ini- update to 5.5.2- improve system libzip patch- 5.5.2RC1- test build with oracle instantclient 12.1- update to 5.5.1 - add Provides: php(pdo-abi), for consistency with php(api) and php(zend-abi) - improved description for mod_php - fix opcache ZTS configuration (blacklists in /etc/php-zts.d) - add missing man pages (phar, php-cgi) - fix php-enchant summary and description- add security fix for CVE-2013-4113 - add missing ASL 1.0 license - 32k stack size seems ok for tests on both 32/64bits build- test build (bundled libgd)- update to 5.5.0 final- also drop JSON from sources - clean conditional for JSON (as removed from the sources) - clean conditional for FPM (always build)- EL-5 rebuild with gd-last- drop JSON extension - build with system GD when 2.1.0 is available- update to 5.5.0RC3-test build with systemd gd- update to 5.5.0RC2 - add missing options in php-fpm.conf - improved systemd configuration, documentation about /etc/sysconfig/php-fpm being deprecated- test build for https://bugs.php.net/64895- test build with systemd integration (type=notify)- update to 5.5.0RC1- test build for libgd- new snapshot - review some sub-packages description - add option to disable json extension- update to 5.5.0beta4, rebuild with new sources- update to 5.5.0beta4- new snapshot - try build with system gd 2.1.0- new snapshot - zend_extension doesn't requires full path - refresh system libzip patch - drop opcache patch merged upstream- allow wildcard in opcache.blacklist_filename and provide default /etc/php.d/opcache-default.blacklist- update to 5.5.0beta3- new snapshot - clean old deprecated options- update to 5.5.0beta2 - Zend Optimizer+ renamed to Zend OPcache - sync provided configuration with upstream- new snapshot - generated parser using system bison, test for https://bugs.php.net/64503- new snapshot (beta1)- new snapshot - temporary disable dtrace - new extension opcache in php-opccache sub-package- new snapshot - hardened build (links with -z now option) - remove %config from /etc/rpm/macros.php- new snapshot (post alpha 6) - make php-mysql package optional (and disabled) - make ZTS build optional (still enabled)- new snapshot- new snapshot (post alpha 5)- enable tokyocabinet and gdbm dba handlers- new snapshot- new snapshot- new snapshot- new snapshot - don't display XFAIL tests in report- new snapshot, alpha4- new snapshot - fix php.conf to allow MultiViews managed by php scripts- new snapshot, alpha3- new snapshot- new snapshot (post alpha2) - use xz compressed tarball- new snapshot- new snapshot- patch for unpack- prevent php_config.h changes across (otherwise identical) rebuilds - drop "Configure Command" from phpinfo output- new snapshot - move gmp in new sub-package- build sockets, tokenizer extensions shared- new snapshot - enable dtrace- build simplexml and xml extensions shared (in php-xml) - build bz2, calendar, ctype, exif, ftp, gettext and iconv extensions shared (in phpx8X.V`]$M]\^@P;a@P4P$P"TP H@O.@O9OOn@MRL@L{@LH2K\K~}@JJ@JJJJ Jyt@Jx"Jq@IܑIJII@I/@HHuHU@H0@H@G Gۺ@GSG FҼF^EvEvEU@D{D@DiD@CR@CqC1K@C(BF@B-B,B@B,B@BMichal Domonkos - 3.10-10Michal Domonkos - 3.10-9Valentina Mukhamedzhanova - 3.10-8Valentina Mukhamedzhanova - 3.10-7Valentina Mukhamedzhanova - 3.10-6Valentina Mukhamedzhanova - 3.10-5Valentina Mukhamedzhanova - 3.10-4Valentina Mukhamedzhanova - 3.10-3Daniel Mach - 3.10-2Zdenek Pavlas - 3.10-1Zdenek Pavlas - 3.10-0Zdenek Pavlas - 3.9.1-33Zdenek Pavlas - 3.9.1-32Zdenek Pavlas - 3.9.1-31Zdenek Pavlas - 3.9.1-30Zdenek Pavlas - 3.9.1-29Zdenek Pavlas - 3.9.1-28Zdenek Pavlas - 3.9.1-26Zdeněk Pavlas - 3.9.1-25Fedora Release Engineering - 3.9.1-24Zdeněk Pavlas - 3.9.1-23Zdeněk Pavlas - 3.9.1-22Zdeněk Pavlas - 3.9.1-21Zdeněk Pavlas - 3.9.1-20Zdeněk Pavlas - 3.9.1-19Zdeněk Pavlas - 3.9.1-18Zdeněk Pavlas - 3.9.1-17Zdeněk Pavlas - 3.9.1-16Zdeněk Pavlas - 3.9.1-15Zdeněk Pavlas - 3.9.1-14Zdeněk Pavlas - 3.9.1-13Zdeněk Pavlas - 3.9.1-12Fedora Release Engineering - 3.9.1-11Fedora Release Engineering - 3.9.1-10Seth Vidal - 3.9.1-9Seth Vidal - 3.9.1-8David Malcolm - 3.9.1-7James Antill 3.9.1-6Seth Vidal - 3.9.1-5Seth Vidal - 3.9.1-4Seth Vidal - 3.9.1-3Seth Vidal - 3.9.1-2Seth Vidal - 3.9.1-1Seth Vidal - 3.9.0-8Seth Vidal - 3.9.0-6Seth Vidal - 3.9.0-5Seth Vidal - 3.9.0-4Seth Vidal - 3.9.0-1James Antill 3.0.0-15Seth Vidal Seth Vidal Fedora Release Engineering - 3.0.0-12Ignacio Vazquez-Abrams 3.0.0-11James Antill 3.0.0-10James Antill 3.0.0-9James Antill 3.0.0-9James Antill 3.0.0-8James Antill 3.0.0-7James Antill 3.0.0-6Robert Scheck 3.0.0-5Jeremy Katz - 3.0.0-4Jeremy Katz - 3.0.0-3Jeremy Katz - 3.0.0-2Jeremy Katz - 3.0.0-1Jeremy Katz - 2.9.9-5Jeremy Katz - 2.9.9-4Florian La Roche James Bowes - 2.9.9-2Jesse Keating - 2.9.9-1.1Jeremy Katz - 2.9.9-1Jeremy Katz - 2.9.8-2Jeremy Katz - 2.9.8-1Jesse Keating Jeremy Katz - 2.9.6-4Jeremy Katz - 2.9.6-3Phil Knirsch 2.9.6-2Jeremy Katz - 2.9.6-1Jeremy Katz - 2.9.5-1Seth Vidal 2.9.5-0Seth Vidal 2xpX/6W1fu$vfueuguPetr Machata - 1.53.0-13Petr Machata - 1.53.0-9Petr Machata - 1.53.0-8Petr Machata - 1.53.0-7Petr Machata - 1.53.0-6Petr Machata - 1.53.0-5Petr Machata - 1.53.0-4Petr Machata - 1.53.0-3Denis Arnaud - 1.53.0-2Petr Machata - 1.53.0-1Peter Robinson 1.50.0-7Denis Arnaud - 1.50.0-6Petr Machata - 1.50.0-5Petr Machata - 1.50.0-4Petr Machata - 1.50.0-3Petr Machata - 1.50.0-2Petr Machata - 1.50.0-1Fedora Release Engineering - 1.48.0-17Petr Machata - 1.48.0-16Petr Machata - 1.48.0-15Petr Machata - 1.48.0-14Petr Machata - 1.48.0-13Robert Scheck - 1.48.0-12Petr Machata - 1.48.0-11Fedora Release Engineering - 1.48.0-10Petr Machata - 1.48.0-9Petr Machata - 1.48.0-8Denis Arnaud - 1.48.0-7Denis Arnaud - 1.48.0-6Denis Arnaud - 1.48.0-5Petr Machata - 1.48.0-4Petr Machata - 1.48.0-3Petr Machata - 1.48.0-2Denis Arnaud - 1.48.0-1Petr Machata - 1.47.0-7Petr Machata - 1.47.0-6Petr Machata - 1.47.0-4Petr Machata - 1.47.0-3Petr Machata - 1.47.0-2Denis Arnaud - 1.47.0-1Peter Robinson - 1.46.1-4Petr Machata - 1.46.1-3Deji Akingunola - 1.46.1-2Denis Arnaud - 1.46.1-1Caolán McNamara - 1.46.0-0.5Denis Arnaud - 1.46.0-0.4Petr Machata - 1.46.0-0.3.beta1Fedora Release Engineering - 1.46.0-0.2.beta1Petr Machata - 1.46.0-0.1.beta1Denis Arnaud - 1.44.0-7Petr Machata - 1.44.0-6Petr Machata - 1.44.0-5Petr Machata - 1.44.0-4Tom "spot" Callaway - 1.44.0-3Tom "spot" Callaway - 1.44.0-2Denis Arnaud - 1.44.0-1.1Denis Arnaud - 1.44.0-1Denis Arnaud - 1.44.0-0.6Denis Arnaud - 1.44.0-0.5Denis Arnaud - 1.44.0-0.4Orcan Ogetbil - 1.44.0-0.3Benjamin Kosnik - 1.44.0-0.2Denis Arnaud - 1.44.0-0.1David Malcolm - 1.41.0-13Petr Machata - 1.41.0-12Petr Machata - 1.41.0-12Dan Horák - 1.41.0-11Petr Machata - 1.41.0-10Rex Dieter - 1.41.0-9Caolán McNamara - 1.41.0-8Petr Machata - 1.41.0-7Petr Machata - 1.41.0-6Denis Arnaud - 1.41.0-5Petr Machata - 1.41.0-5Petr Machata - 1.41.0-4Petr Machata - 1.41.0-3Denis Arnaud - 1.41.0-2.2Petr Machata - 1.41.0-2Benjamin Kosnik - 1.41.0-1Denis Arnaud - 1.41.0-0.7Denis Arnaud x(`X0]`p{i$_iiieleng@fedoraproject.org> - 0.21.1-2Eli Young - 0.21.1-1Eli Young - 0.20.0-1Eli Young - 0.19.0-1Eli Young - 0.18.2-2Nick Bebout - 0.18.2-2Nick Bebout - 0.18.2-1Nick Bebout - 0.18.1-1Fedora Release Engineering - 0.14.1-2James Hogarth - 0.14.1-1James Hogarth - 0.14.0-1James Hogarth - 0.13.0-1James Hogarth - 0.12.0-1Fedora Release Engineering - 0.11.1-2James Hogarth - 0.11.1-1Nick Bebout - 0.9.3-1Nick Bebout - 0.9.2-1Fedora Release Engineering - 0.8.1-2James Hogarth - 0.8.1-2Nick Bebout - 0.8.1-1James Hogarth - 0.8.0-2james - 0.8.0-1James Hogarth - 0.7.0-1James Hogarth - 0.6.0-2James Hogarth - 0.6.0-1- Update to 1.11.0 (#1913018)- Update to 1.10.1 (#1904184)- Update to 1.10.0 (#1903311)- Update to 1.9.0- Update to 1.8.0- Update to 1.7.0 (#1866069)- Rebuilt for https://fedoraproject.org/wiki/Fedora_33_Mass_Rebuild- Update to 1.6.0 (#1854617)- Update to 1.5.0 (#1843202)- Rebuilt for Python 3.9- Update to 1.4.0 (#1831915)- Update to 1.3.0 (#1809791)- remove runtime dependencies on mock, pytest- Update to 1.2.0 (#1791074)- add missing sources- Update to 1.1.0 (#1791074)- Rebuilt for https://fedoraproject.org/wiki/Fedora_32_Mass_Rebuild- Update to 1.0.0 (#1769106)- Verify source OpenPGP signature- Update to 0.39.0 (#1757576)- Update to 0.38.0 (#1748614)- Update to 0.37.2 (#1742578)- Rebuilt for Python 3.8- Rebuilt for https://fedoraproject.org/wiki/Fedora_31_Mass_Rebuild- Update to 0.36.0- Update to 0.35.1 (#1717678)- Update to 0.34.2 (#1686185) (#1706298) (#1701018)- Update to 0.31.0 (#1673770)- Rebuilt for https://fedoraproject.org/wiki/Fedora_30_Mass_Rebuild- Update to 0.30.2 (#1669314)- Update to 0.29.1 - Remove Python 2 package in Fedora 30+ (#1654016)- Update to 0.28.0- Update to 0.27.1 (#1627570)- Update to 0.26.1 (#1600293)- Rebuilt for https://fedoraproject.org/wiki/Fedora_29_Mass_Rebuild- Rebuilt for Python 3.7- Update to 0.25.1 (#1591032)- Update to 0.25.0 (#1588220)- Remove unnecessary patch- Update to 0.24.0 (#1574151)- Update to 0.23.0 (#1563900)- Update to 0.22.2 (#1558281)- Update to 0.22.0 (#1552954)- Update Python 2 dependency declarations to new packaging standards (See https://fedoraproject.org/wiki/FinalizingFedoraSwitchtoPython3)- Rebuilt for https://fedoraproject.org/wiki/Fedora_28_Mass_Rebuild- Update to 0.21.1 (#1535996)- Update to 0.20.0- Update to 0.19.0 (bz#1499369)- Fix condition on provides for Fedora pre-26 - bz#1497314- Fix provides - bz#1497314- Update to 0.18.2- Update to 0.18.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_27_Mass_Rebuild- Update to 0.14.1- Update to 0.14.0- update to 0.13.0- update to 0.12.0 - add python3 compatibility- Rebuilt for https://fedoraproject.org/wiki/Fedora_26_Mass_Rebuild- Upgrade to 0.11.1 - Add requires on mod_ssl bz#1367943- Update to 0.9.3- Update to 0.9.2- https://fedoraproject.org/wiki/Changes/Automatic_Provides_for_Python_RPM_Packages- Spec bug on el7 requires - bz#1347997- Update to 0.8.1- Move recommends to correct subpackage - change to require python-augeas as python2-augeas not provided in F23 - change the python-devel BR as per review- update to upstream 0.8.0 release- Update to 0.7.0 release- Ensure python2-* provide is present as per python guidelines- Initial packaging of the pluginpython-certbot-apachexOX1W @v$P@v?v GES//usr/share/locale/es/LC_MESSAGES//usr/share/locale/fi/LC_MESSAGES//usr/share/locale/fr/LC_MESSAGES//usr/share/locale/ga/LC_MESSAGES//usr/share/locale/ko/LC_MESSAGES//usr/share/locale/nl/LC_MESSAGES//usr/share/locale/pl/LC_MESSAGES//usr/share/locale/pt_BR/LC_MESSAGES//usr/share/locale/ro/LC_MESSAGES//usr/share/locale/ru/LC_MESSAGES//usr/share/locale/sv/LC_MESSAGES//usr/share/locale/tr/LC_MESSAGES//usr/share/locale/vi/LC_MESSAGES//usr/share/locale/zh_CN/LC_MESSAGES//usr/share/man/man1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=9be95af2cb5a04d6a8ee82ff3da1538361c00d76, strippedC++ source, ASCII textdirectoryASCII texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression) R RR RR R RRR RR?@`[P$ƨ뒸y =ପ=iIi,krh<7yt(xjA"0NxRՍ^ mf:pd _{"åiAP{ÜV[ğ`H]̿s){M@Z< 瀸'Q< ihX{ XT>vޫh@Q{H趆=]plv:$鑄'oY!C"uD@ӭoƌБ_|Lby?^4k 0/+lz 06n1H<-)PqK߶|:\EAw2^H R7nZô/^`1&őxˉ[P$ƨ=O3Gb'g&Hknqf~2~P3Nn@ ̆Љ 5P/\L'lh.)ӊ1i'PQQNjaav1]-]G9p"14Td+ޏ  q89316a65a71e473d1691106a5366bee3b98466349b  `b Y1sysc_inotify_rm_watch.stpgXrsysc_inotify_init.stpfW/sysc_inotify_add_watch.stpebueVasysc_init_module.stp/dUnsysc_getxattr.stpcT.sysc_getuid.stp/mbSsysc_gettimeofday.stpaR.sysc_gettid.stpbu`Qasysc_getsockopt.stp_P/sysc_getsockname.stp.^O6sysc_getsid.stpua]Nbsysc_getrusage.stpsr/\M/sysc_getrlimit.stpx86psysc_getresuid16.stps[Lnsysc_getresuid.stpmatxsysc_getresgid16.stplZK}sysc_getresgid.stpls/YJ.sysc_getrandom.stp/inXIlsysc_getpriority.stpWH/sysc_getppid.stp.VG6sysc_getpid.stpuaUFnsysc_getpgrp.stp/TEnsysc_getpgid.stp1SD.sysc_getpeername.stpxRC/sysc_getitimer.stp60.QB6sysc_gethostname.stpgPAesysc_getgroups.stpsr/O@/sysc_getgid.stpl7N?usysc_geteuid.stpcM>dsysc_getegid.stp/L=/sysc_getdents.stpx?X2VfI$vfIeIgIZaZ_:Z\ZTZOhZ/Z/Z/Z*~ZZYYp@Y@Y?Y>@Y:Y6@Y1S@Y"Y@YYXX-XP@XO@XBX|XOX@W W@WWڍ@W@WRWίWίWiWWu@W@W@WW@W@WWj}WUeWN@W Vn@V@V@V.V+rV*!@V'~@V&,V$@VVV@V@VZV @VV V }@V7@VVVBU@U@UYUU@UUUUUoU@U@U5@U@U@UU@UUU@U@UUU@U.RUF@T T@T@T}T@TTTTTTTTq@TTT@T@TLTxcTto@Tk4TeT`T\@T\@TAT7@T7@T5'@T5'@T%U@T!`T @T @TwTwT&@T@TT TT@S@SS@SFSSSSS@S @SSg@SrS!@S!@SS}SpSb7@SB@S;S4S2@S2@S1oS,)S,)S&S!SS@S(SR@R@RJ@RUR@R߲R߲RR=RkR@RR;RRRRRRiRiR|@R|@RxRpRW@RNRM\@RJ@R<8R2@R)R6Q@QQQQɆ@Q@QxQ'@QQR@Q-@Q:@QP@PZP7@P7@P@P@P{P{Pp@PnPmz@P3x@PP - 1:1.18.8-2Thomas Haller - 1:1.18.8-1Beniamino Galvani - 1:1.18.6-4Beniamino Galvani - 1:1.18.6-3Thomas Haller - 1:1.18.6-2Beniamino Galvani - 1:1.18.6-1Beniamino Galvani - 1:1.18.4-3Beniamino Galvani - 1:1.18.4-2Thomas Haller - 1:1.18.4-1Beniamino Galvani - 1:1.18.0-6Lubomir Rintel - 1:1.18.0-5Beniamino Galvani - 1:1.18.0-4Lubomir Rintel - 1:1.18.0-3Lubomir Rintel - 1:1.18.0-2Thomas Haller - 1:1.18.0-1Thomas Haller - 1:1.18.0-0.6Thomas Haller - 1:1.18.0-0.5Francesco Giudici - 1:1.18.0-0.4.20190408git43d9187c14Lubomir Rintel - 1:1.18.0-0.3.20190408git43d9187c14Lubomir Rintel - 1:1.18.0-0.2.20190404git9a8fe5f339Lubomir Rintel - 1:1.16.2-0.2.20190328git8ec0954570Beniamino Galvani - 1:1.12.0-7Beniamino Galvani - 1:1.12.0-6Beniamino Galvani - 1:1.12.0-5Beniamino Galvani - 1:1.12.0-4Lubomir Rintel - 1:1.12.0-3Beniamino Galvani - 1:1.12.0-2Thomas Haller - 1:1.12.0-1Beniamino Galvani - 1:1.12.0-0.2Thomas Haller - 1:1.12.0-0.1Thomas Haller - 1:1.10.2-16Beniamino Galvani - 1:1.10.2-15Beniamino Galvani - 1:1.10.2-14Frx.X3Wx$QMTAconfig(sendmail)sendmailsendmail(x86-64)server(smtp)smtpdaemon @ @@@@@@@@@@@@@@@@@@@@@@@@@   @  /bin/sh/bin/sh/bin/sh/bin/sh/bin/sh/bin/sh/usr/sbin/alternatives/usr/sbin/alternatives/usr/sbin/alternatives/usr/sbin/saslauthdbashconfig(sendmail)coreutilscoreutilsinitscriptslibc.so.6()(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypt.so.1()(64bit)libcrypto.so.10()(64bit)libcrypto.so.10(OPENSSL_1.0.1_EC)(64bit)libcrypto.so.10(OPENSSL_1.0.2)(64bit)libcrypto.so.10(libcrypto.so.10)(64bit)libdb-5.3.so()(64bit)libhesiod.so.0()(64bit)liblber-2.4.so.2()(64bit)libldap-2.4.so.2()(64bit)libnsl.so.1()(64bit)libnsl.so.1(GLIBC_2.2.5)(64bit)libresolv.so.2()(64bit)libresolv.so.2(GLIBC_2.2.5)(64bit)libsasl2.so.3()(64bit)libssl.so.10()(64bit)libssl.so.10(libssl.so.10)(64bit)libwrap.so.0()(64bit)procmailrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)setupshadow-utilssystemdsystemdsystemdsystemd-sysvrpmlib(PayloadIsXz)2.08.14.7-6.el73.0.4-14.6.0-14.0-12.5.31-15.2-14.11.3/usr/bin/systemd-sysv-convert --save sendmail >/dev/null 2>&1 ||: /bin/systemctl enable sendmail.service >/dev/null 2>&1 /bin/systemctl enable sm-client.service >/dev/null 2>&1 /sbin/chkconfig --del sendmail >/dev/null 2>&1 || : /bin/systemctl try-restart sendmail.service >/dev/null 2>&1 || : /bin/systemctl try-restart sm-client.service >/dev/null 2>&1 || : # workaround for systemd rhbz#738022 /bin/systemctl is-active sendmail.service >/dev/null 2>&1 && \ ! /bin/systemctl is-active sm-client.service >/dev/null 2>&1 && \ /bin/systemctl start sm-client.service >/dev/null 2>&1 || :sendmail8.14.5-3]9XӸRUR@RkQsQ+R@QP@PCP ORO~On@N@NS@NoEN\N\N-ZN)f@N$ @N e@M@Mc@MoMRM-M*L@L@L*@LL@LuLjyLYV@L5LL%@L0LKKy7@KjKhK@K'z@J@J@JlE@I2IuIKI6tHHuG/@GD@GVGEo@Fl@F_FҼFF#e@F@F@EmEEt El$D@D Dp@D@D@DDD!<@CC@CCqCs6@CJWC.@B{\@Bo~B[@B9q@B06B$Y@A@A@AT@A~<@A5A,@@@@@~y@@s@@mU@l@@j@j@X=@Dw@@4@@4@@"0@@@@@@@@i@ @@@@@?P?@?\@?s@?ĕ??@?r?i@?hL?S4?3?'@?l@?&@>@>ؙ@>;@>@>R@>@>s>@>@>e>Z @>Z @>Z @>H>.>.>"@>!X> @>o=(=K@=@=@==þ@===n =?@=>=>=-s@= D@=@=@=@<< - 8.14.7-6Jaroslav Škarvada - 8.14.7-5Daniel Mach - 8.14.7-4Jaroslav Škarvada - 8.14.7-3Daniel Mach - 8.14.7-2Robert Scheck - 8.14.7-1Jaroslav Škarvada - 8.14.6-4Fedora Release Engineering - 8.14.6-3Jaroslav Škarvada - 8.14.6-2Robert Scheck - 8.14.6-1Fedora Release Engineering - 8.14.5-15Jaroslav Škarvada = 3 (#9929). - update to ss000121: -- clockdiff: preserve raw socket errno. -- ping: change error exit code to 1 (used to be 92,93, ...) -- ping,ping6: if -w specified, transmit until -c limit is reached. -- ping,ping6: exit code non-zero if some packets not received within deadline.- man page corrections (#9690).- add ifenslave.- List /usr/sbin/rdisc in %files list.- add remaining binaries. - casts to remove compilation warnings. - terminate if -w deadline is reached exactly (#8724).- create (only ping for now, traceroute et al soon)./bin/sh/bin/sh/bin/sh 20160308-10.el720160308-10.el720160308-10.el7rdiscpingping6tracepathtracepath6rdisc.servicearpingclockdiffifenslaveping6rdisctracepathtracepath6iputils-20160308README.bondingRELNOTESarping.8.gzclockdiff.8.gzifenslave.8.gzping.8.gzping6.8.gzrdisc.8.gztracepath.8.gztracepath6.8.gz/etc/sysconfig//usr/bin//usr/lib/systemd/system//usr/sbin//usr/share/doc//usr/share/doc/iputils-20160308//usr/share/man/man8/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnu  ASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=ee6509caca6172c6eceab6db498cd3594a9002bc, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=50e8d3254f670528c1b8b23aba20ba99749253cc, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=c9f1a406732f3e7aece6901a4f04b46bdb5135d0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=6f97ab152fb4008c21d1e7e097c33b33b8175060, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked (usesx X5Vx$x(instead of php-mssql) - disable oci8 extension, not yet adapted for 7.0 - add php-zip subpackage - add php-json subpackage- Update to 5.6.7 http://www.php.net/releases/5_6_7.php- update to 5.6.7RC1- Update to 5.6.6 http://www.php.net/releases/5_6_6.php- Update to 5.6.5 http://www.php.net/releases/5_6_5.php- fix php-fpm.service.d location- update to 5.6.5RC1 - add base system path in default include path - FPM: enable ACL for Unix Domain Socket- Update to 5.6.4 http://www.php.net/releases/5_6_4.php - add sybase_ct extension (in mssql sub-package) - xmlrpc requires xml- Update to 5.6.4 http://www.php.net/releases/5_6_4.php- update to 5.6.4RC1- add embedded sub package - filter all libraries to avoid provides- FPM: add upstream patch for https://bugs.php.net/68421 access.format=R doesn't log ipv6 address - FPM: add upstream patch for https://bugs.php.net/68420 listen=9000 listens to ipv6 localhost instead of all addresses - FPM: add upstream patch for https://bugs.php.net/68423 will no longer load all pools- Update to PHP 5.6.3 http://php.net/releases/5_6_3.php- update to 5.6.3RC1 - new version of systzdata patch, fix case sensitivity - ignore Factory in date tests - disable opcache.fast_shutdown in default config - add php56-cgi command in base system- Update to PHP 5.6.2 http://php.net/releases/5_6_2.php- Update to PHP 5.6.1 http://php.net/releases/5_6_1.php - use default system cipher list by Fedora policy http://fedoraproject.org/wiki/Changes/CryptoPolicy - add system php library to default include_path- enable libvpx on EL 6 (with libvpx 1.3.0) - add php56-phpdbg command in base system- PHP 5.6.0 is GA - add lsphp56 command in base system- initial spec for PHP 5.6 as Software Collection - adapted from php 5.6 spec file from remi repository - adapted from php 5.5 spec file from rhscl 1.1- fileinfo: fix out-of-bounds memory access CVE-2014-2270 - fileinfo: fix extensive backtracking CVE-2013-7345- gd: fix NULL deref in imagecrop CVE-2013-7327 - gd: drop vpx support, fix huge memory consumption #1075201- fix patch name - fix memory leak introduce in patch for CVE-2014-1943 - fix heap-based buffer over-read in DateInterval CVE-2013-6712- fix infinite recursion in fileinfo CVE-2014-1943- fix heap overflow vulnerability in imagecrop CVE-2013-7226- allow multiple paths in ini_scan_dir #1058161- add security fix for CVE-2013-6420- rebuild with test enabled - add dependency on php-pecl-jsonc- update to PHP 5.5.6 - buildstrap build- update to PHP 5.5.5 - mod_php only for httpd24- update to PHP 5.5.4 - improve security, use specific soap.wsdl_cache_dir use /var/lib/php/wsdlcache for mod_php and php-fpm - sync short_tag comments in php.ini with upstream - relocate RPM macro- update to PHP 5.5.3 - improve system libzip patch - fix typo and add missing entries in php.ini- update to PHP 5.5.1 for php55 SCL- rebuild for new httpd-mmn value- remove ZTS conditional stuf for ligibility - add mod_php for apache 2.4 (from httpd24 collection)- improve mod_php, pgsql and ldap description - add missing man pages (phar, php-cgi) - add provides php(pdo-abi) for consistency with php(api) and php(zend-abi) - use %__isa_bits instead of %__isa in ABI suffix #985350- add security fix for CVE-2013-4113 - add missing ASL 1.0 license- run tests during build- rebase to 5.4.16 - fix hang in FindTishriMolad(), #965144 - patch for upstream Bug #64915 error_log ignored when daemonize=0 - patch for upstream Bug #64949 Buffer overflow in _pdo_pgsql_error, #969103 - patch for upstream bug #64960 Segfault in gc_zval_possible_root- remove wrappers in /usr/bin (#966407)- rebuild for libjpeg (instead of libjpeg_turbo) - fix unowned dir %{_datadir}/fpm and %{_libdir}/httpd (#956221)- update to 5.4.14 - clean old deprecated options- update to 5.4.13 - security fixes for CVE-2013-1635 and CVE-2013-1643 - make php-mysql package optional (and disabled) - make ZTS build optional (and disabled) - always try to load mod_php (apache warning is usefull) - Hardened build (links withxX6WXQ$TP?d   A48PT[d 8MPM M M M %EM & M'TM(M*Y*xM++4,404(1U)1\*3+3,3-38398:g=>?@DGMH<MIpMXY\M]8M^bDd eflt,Mu`Mvؔw<MxpMy $ 4 Lx|MghCsendmail8.14.76.el7A widely used Mail Transport Agent (MTA)The Sendmail program is a very widely used Mail Transport Agent (MTA). MTAs send mail from one machine to another. Sendmail is not a client program, which you use to read your email. Sendmail is a behind-the-scenes program which actually moves your email over networks or the Internet to where you want it to go. If you ever need to reconfigure Sendmail, you will also need to have the sendmail-cf package installed. If you need documentation on Sendmail, you can install the sendmail-doc package.^~x86-02.bsys.centos.orgvMCentOSSendmailCentOS BuildSystem System Environment/Daemonshttp://www.sendmail.org/linuxx86_64getent group mailnull >/dev/null || \ /usr/sbin/groupadd -g 47 -r mailnull >/dev/null 2>&1 getent passwd mailnull >/dev/null || \ /usr/sbin/useradd -u 47 -g mailnull -d /var/spool/mqueue -r \ -s /sbin/nologin mailnull >/dev/null 2>&1 getent group smmsp >/dev/null || \ /usr/sbin/groupadd -g 51 -r smmsp >/dev/null 2>&1 getent passwd smmsp >/dev/null || \ /usr/sbin/useradd -u 51 -g smmsp -d /var/spool/mqueue -r \ -s /sbin/nologin smmsp >/dev/null 2>&1 # hack to turn sbin/makemap and man8/makemap.8.gz into alternatives symlink [ -h /usr/sbin/makemap ] || rm -f /usr/sbin/makemap || : [ -h /usr/share/man/man8/makemap.8.gz ] || rm -f /usr/share/man/man8/makemap.8.gz || : exit 0 if [ $1 -eq 1 ] ; then # Initial installation systemctl preset sendmail.service sm-client.service >/dev/null 2>&1 || : fi # Set up the alternatives files for MTAs. /usr/sbin/alternatives --install /usr/sbin/sendmail mta /usr/sbin/sendmail.sendmail 90 \ --slave /usr/sbin/makemap mta-makemap /usr/sbin/makemap.sendmail \ --slave /usr/sbin/editmap mta-editmap /usr/sbin/editmap.sendmail \ --slave /usr/bin/mailq mta-mailq /usr/bin/mailq.sendmail \ --slave /usr/bin/newaliases mta-newaliases /usr/bin/newaliases.sendmail \ --slave /usr/bin/rmail mta-rmail /usr/bin/rmail.sendmail \ --slave /usr/lib/sendmail mta-sendmail /usr/lib/sendmail.sendmail \ --slave /etc/pam.d/smtp mta-pam /etc/pam.d/smtp.sendmail \ --slave /usr/share/man/man8/sendmail.8.gz mta-sendmailman /usr/share/man/man8/sendmail.sendmail.8.gz \ --slave /usr/share/man/man1/mailq.1.gz mta-mailqman /usr/share/man/man1/mailq.sendmail.1.gz \ --slave /usr/share/man/man1/newaliases.1.gz mta-newaliasesman /usr/share/man/man1/newaliases.sendmail.1.gz \ --slave /usr/share/man/man5/aliases.5.gz mta-aliasesman /usr/share/man/man5/aliases.sendmail.5.gz \ --slave /usr/share/man/man8/rmail.8.gz mta-rmailman /usr/share/man/man8/rmail.sendmail.8.gz \ --slave /usr/share/man/man8/makemap.8.gz mta-makemapman /usr/share/man/man8/makemap.sendmail.8.gz \ --slave /usr/share/man/mxpX7UWw$Y_G$ƨMT )nO~OU(rSxx۷rBm“7yDŽ@V=V^zv(9$H&w4q2A)s2L<3$Xל"T|zKs}htH(#h|V8f|7QAڟzMHz9p6a>ܠDWYA784x&j2]/Y9OrR¦gk5(džԬ$ǑBЏ(py]r-h3k7^Bjz(nW ͯf`y Z8Kܳ` fcCnf.o`&k{v/[A~1P?t$=JclHY4bBBc#5zP#Q~Y8ZHr~4U=)=X2Xq|d4ԟޣF{w8CԽT ܆O/bĦX Xʉi"_9TD`uܩ~3Dd } ?SK,=6Iو뀉@ L[;o^54%vti1=03& A7~;<Ձc3ExLQ1OrYMt=2;Gp^u ~S8= 2.16 (#505596)- don't mess up problem altNEVR in python ts.check() (#501068) - fix hardlink size calculation on build (#503020)- split cron-job into a sub-package to avoid silly deps on core rpm (#500722) - rpm requires coreutils but not in %post - build with libcap and libacl - fix pgp pubkey signature tag parsing- couple of merge-review fixes (#226377) - eliminate bogus leftover rpm:rpm rpmdb ownership - unescaped macro in changelog - fix find-lang --with-kde with KDE3 (#466009) - switch back to default file digest algorithm- file classification tweaks for text files (#494817) - disable libmagic text token checks, it's way too error-prone - consistently classify all text as such and include description- update to 4.7.0 final (http://rpm.org/wiki/Releases/4.7.0) - fixes #494049, #495429 - dont permit test-suite failure anymore- update to 4.7.0-rc1 - fixes #493157, #493777, #493696, #491388, #487597, #493162- fix recorded file state of otherwise skipped files (#492947) - compress ChangeLog, drop old CHANGES file (#492440)- Fix sparcv9v xX8W@0K@c$P@c?cAc.4.4-1Remi Collet 5.4.3-1Remi Collet 5.4.2-1Remi Collet 5.4.1-1Joe Orton - 5.4.0-6Remi Collet 5.4.0-5Joe Orton - 5.4.0-4Joe Orton - 5.4.0-3Joe Orton - 5.4.0-2Remi Collet 5.4.0-1Remi Collet 5.4.0-0.4.RC8Remi Collet 5.4.0-0.3.RC7Remi Collet 5.4.0-0.2.RC6Remi Collet 5.4.0-0.1.RC6Remi Collet 5.3.8-4.4Remi Collet 5.3.8-4.3Adam Jackson - 5.3.8-4.2Marcela Mašláňová - 5.3.8-3.2Peter Schiffer - 5.3.8-3.1Remi Collet 5.3.8-3Remi Collet 5.3.8-2Remi Collet 5.3.8-1Remi Collet 5.3.7-1Joe Orton - 5.3.6-4Remi Collet 5.3.6-3Remi Collet 5.3.6-2Remi Collet 5.3.6-1Joe Orton - 5.3.5-6Caolán McNamara 5.3.5-5Remi Collet 5.3.5-4Remi Collet 5.3.5-3Fedora Release Engineering - 5.3.5-2Remi Collet 5.3.5-1Remi Collet 5.3.4-2Remi Collet 5.3.4-1.1Remi Collet 5.3.4-1Remi Collet 5.3.3-5Joe Orton - 5.3.3-4Joe Orton - 5.3.3-3Remi Collet 5.3.3-2Remi Collet 5.3.3-1Remi Collet 5.3.2-3Caolán McNamara 5.3.2-2Remi Collet 5.3.2-1Joe Orton - 5.3.1-3Joe Orton - 5.3.1-2Remi Collet 5.3.1-1Tom "spot" Callaway - 5.3.0-7Tomas Mraz - 5.3.0-6Fedora Release Engineering - 5.3.0-5Joe Orton 5.3.0-4Joe Orton 5.3.0-3Joe Orton 5.3.0-2Remi Collet 5.3.0-1Remi Collet 5.2.10-1Remi Collet - 5.2.9-1Fedora Release Engineering - 5.2.8-10Joe Orton 5.2.8-9Joe Orton 5.2.8-8Joe Orton 5.2.8-7Joe Orton 5.2.8-5Joe Orton 5.2.8-4Joe Orton 5.2.8-3Remi Collet 5.2.8-2Remi Collet 5.2.8-1Remi Collet 5.2.7-1.1Remi Collet 5.2.7-1Joe Orton 5.2.6-7Joe Orton 5.2.6-6Remi Collet 5.2.6-5Remi Collet 5.2.6-4Joe Orton 5.2.6-3Joe Orton 5.2.5-7Fedora Release Engineering - 5.2.5-6Joe Orton 5.2.5-5Joe Orton 5.2.5-4Release Engineering - 5.2.5-3Joe Orton 5.2.5-2Joe Orton 5.2.4-3Joe Orton 5.2.4-2Joe Orton 5.2.3-9Joe Orton 5.2.3-8Hans de Goede 5.2.3-7Joe Orton 5.2.3-6Joe Orton 5.2.3-5Joe Orton 5.2.3-4Joe Orton 5.2.3-3Joe Orton 5.2.3-2Joe Orton 5.2.2-4Joe Orton 5.2.2-3Joe Orton 5.2.2-2Joe Orton 5.2.1-5Joe Orx`X9%X0t^$D^^C?d  XPTx|  $ 4 T  $Dl8p(8 9 : 8 G@H`IXY\]^ bVdefltu0vPwxy(,D T lghCnload0.7.44.el7A tool can monitor network traffic and bandwidth usage in real timenload is a console application which monitors network traffic and bandwidth usage in real time. It visualizes the in and outgoing traffic using two graphs and provides additional info like total amount of transfered data and min/max network usage.T$`buildhw-01.phx2.fedoraproject.org5Fedora ProjectFedora ProjectGPLv2+Fedora ProjectApplications/Systemhttp://www.roland-riegel.de/nload/linuxx86_64bU; A큤T$`T$`=6.?g!O/P;MT$`0d334f0d7c09bcc2f37eb9e12f52909d854fb82fcc17db3adac6ca8590550355b481d3f3d4b7c82ffcb32d7c38585761933c0b8997411815220ca477277eda8f67f82e045cf7acfef853ea0f426575a8359161a0a325e19f02b529a87c4b6c34ff7ac87200d50e6de052c32e740aa22658700c9ae3babacf8624e1caa716384e01ba4719c80b6fe911b091a7c05124b64eeece964e09c058ef8f9805daca546bd0e3a942ec515e69c4051c907eeb0406d61cca894f32e7cae5a731b94267af47b5914c59ebe8d99f5aeb2b878d867630a3074351bd7ea19bcd058c35edaf92ebrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootnload-0.7.4-4.el7.src.rpmnloadnload(x86-64)@@@@@@@@@@@@@@@@   @ libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)libform.so.5()(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libm.so.6()(64bit)libncurses.so.5()(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libstdc++.so.6(GLIBCXX_3.4)(64bit)libstdc++.so.6(GLIBCXX_3.4.11)(64bit)libstdc++.so.6(GLIBCXX_3.4.15)(64bit)libstdc++.so.6(GLIBCXX_3.4.9)(64bit)libtinfo.so.5()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.1S@SQQJQP H@OLOMQ0@JjI2IO@IN/Fedora Release Engineering - 0.7.4-4Fedora Release Engineering - 0.7.4-3Fedora Release Engineering - 0.7.4-2Christopher Meng - 0.7.4-1Fedora Release Engineering - 0.7.2-9Fedora Release Engineering - 0.7.2-8Fedora Release Engineering - 0.7.2-7Fedora Release Engineering - 0.7.2-6Fedora Release Engineering - 0.7.2-5Fedora Release Engineering - 0.7.2-4Fedora Release Engineering - 0.7.2-3Itamar Reis Peixoto - 0.7.2-2Itamar Reis Peixoto - 0.7.2-1- Rebuilt for https://fedoraproject.org/wiki/Fedora_21_22_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/FexغX:Vj$pjjjrget/52550, target/54639, target/54640, target/54662, target/56444, target/56445, target/56455, testsuite/52641, tree-optimization/55481, tree-optimization/56175, tree-optimization/56294, tree-optimization/56310, tree-optimization/56415, tree-optimization/56426, tree-optimization/56443, tree-optimization/56448 - fnsplit fix (PR tree-optimization/56424)- updated from trunk - PRs asan/56330, c++/51242, c++/54276, c++/56373, libquadmath/56379, middle-end/55889, middle-end/56349, pch/54117, rtl-optimization/56348, target/52555, target/54685, target/56214, target/56347, tree-optimization/55334, tree-optimization/56321, tree-optimization/56350, tree-optimization/56366, tree-optimization/56381, tree-optimization/56384, tree-optimization/56396, tree-optimization/56398 - add BuildRequires: /usr/bin/pod2man to fix man pages generation - don't ICE on bogus inline asm in kernel (#912857, PR inline-asm/56405) - fix up info page building with texinfo 5.0 (PR bootstrap/56258) - devirtualization ICE fix (PR tree-optimization/56265)- updated from trunk - PRs bootstrap/56327, c++/52026, c++/54922, c++/55003, c++/55220, c++/55223, c++/55232, c++/55582, c++/55670, c++/55680, c++/56323, c++/56343, fortran/53818, fortran/56224, fortran/56318, libstdc++/56111, lto/50494, target/55431, target/55941, testsuite/56138 - asan fixes (PR sanitizer/56330) - asan speedup - use 0x7fff8000 shadow offset instead of 1LL << 44 on x86_64- updated from trunk - PRs c++/55710, c++/55879, c++/55993, c++/56135, c++/56155, c++/56285, c++/56291, c/44938, fortran/46952, fortran/56204, inline-asm/56148, libitm/55693, lto/56295, lto/56297, middle-end/56288, sanitizer/56128, target/52122, testsuite/56082 - fix IRA bug that caused reload ICE on ARM (#910153, target/56184) - attempt harder to fold "n" constrainted asm input operands in C++ with -O0 (#910421, c++/56302)- updated from trunk - PRs c++/56238, c++/56247, c++/56268, fortran/55362, libstdc++/56267, libstdc++/56278, libstdc++/56282, rtl-optimization/56246, rtl-optimization/56275, target/56043, tree-optimization/56264, tree-optimization/56273 - improve expansion of mem1 op= mem2 (PR rtl-optimization/56151)- updated from trunk - PRs bootstrap/56227, c++/56235, c++/56237, c++/56239, c++/56241, debug/53363, fortran/54339, fortran/55789, libstdc++/56193, libstdc++/56216, lto/56231, middle-end/56181, rtl-optimization/56195, rtl-optimization/56225, target/50678, target/54009, target/54131, tree-optimization/56250 - fix Ada frontend miscompilation with profiledbootstrap (#906516, PR rtl-optimization/56178) - restore parsing of ppc inline asm dialects (#909298, PR target/56256) - fix up libiberty old regex (PR other/56245) - fix IRA -O0 -g code debug regression (PR debug/53948)- updated from trunk - PRs c++/54122, c++/56177, c++/56208, debug/54793, fortran/47517, fortran/50627, fortran/54195, fortran/56008, fortran/56054, libstdc++/56202, lto/56168, middle-end/56113, middle-end/56167, middle-end/56217, rtl-optimization/56131, sanitizer/55617, target/52123, target/54601, target/55146, target/56186, tree-optimization/53185, tree-optimization/53342, tree-optimization/54386, tree-optimization/55789, tree-optimization/56188 - fix up stdarg pass (PR tree-optimization/56205, #906367) - remove unused thread_local bitfield (#907882) - fix cselim pass on calls that might free memory (PR tree-optimization/52448) - fix libgfortran internal_pack (PR fortran/55978) - fix up .debug_loc for first function in CU, if it contains empty ranges at the beginning of the function (PR debug/56154, #904252) - fix ppc64 indirect calls (PR target/56228, #908388)- updated from trunk - PRs c++/56162, debug/54410, debug/54508, debug/55059, fortran/54107, fortran/56138, libgomp/55561, libstdc++/54314, lto/56147, middle-end/53073, other/53413, other/54620, rtl-optimization/56144, sanitizer/55374, target/39064, target/56121, tree-optimization/55270, tree-optimization/56064, tree-optimization/56113, tree-optimization/56150, tree-optimization/56157- uxPX;W$-llowing disablement of TLS 1.1/2 Resolves: rhbz#1281476 - Fixed problem with e-mails not sending from IPv6 enabled server to servers with MX record pointing to CNAME Resolves: rhbz#1294870 - Added editmap Resolves: rhbz#1342393 - Removed systemd limit for sendmail restarts to workaround failure due to rapid restarts caused by NetworkManager dispatcher script Resolves: rhbz#1395102 - Fixed op.pdf Resolves: rhbz#1401070- Mass rebuild 2014-01-24- Build with -O3 on ppc64 Resolves: rhbz#1051077- Mass rebuild 2013-12-27- Upgrade to 8.14.7- Switched to systemd-rpm macros Resolves: rhbz#850310- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Fixed milter_helo regression (milter-helo-fix patch) Resolves: rhbz#895552 - Fixed bogus dates in changelog- Upgrade to 8.14.6- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Used power64 macro to support more subarchitectures like ppc64p7 Resolves: rhbz#834626- Rebuilt with libdb-5.2- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Added tighter bound to sm-client.service and sendmail.service Resolves: rhbz#756232- The nm-dispatcher now uses try-restart instead of restart Resolves: rhbz#748416- Enabled alternatives --initscript in post section - Improved sysvinit subpackage - switched to noarch, added scriptlets - Workarounded sm-client stop on SysV to systemd migration- Enable override of hardened build settings- Hardened build with full relro - Provided SysV initscript in sysvinit subpackage for backward compatibility- Fixed systemctl disable command in preun section - Replaced reload by restart, dropped ExecReload from sendmail.service Resolves: rhbz#719931 - Switched to systemctl in NetworkManager dispatcher script - Added ExecStartPre=-/etc/mail/make to sm-client.service - Hardcoded daemon option (-bd) to sendmail.service, dropped the DAEMON var - QUEUE var in /etc/sysconfig/sendmail replaced by SENDMAIL_OPTS var - Added default preset (-q1h) to SENDMAIL_OPTS var- Fixed SMTP AUTH over TLS in case of two AUTH lines Resolves: rhbz#716628- Removed dots from description (there are no dots in systemd packaging guidelines) - Changed service type to forking and explicitly specified PID files - Fixed creation of sm-client.pid - Added Wants to sm-client.service and sendmail.service - Replaced each occurrence of /var/run by /run in config files - More details are available in rhbz#697636- Introduce systemd unit file, drop SysV support- Rebuilt with libdb-5.2- New version 8.14.5 - Removed m4-ldap-routing, milter-fix-negativeid, man-i-option-fix patches (upstreamed)- fix negative ctx_id in milter debug output (#577558) - fix incomplete description of the -i option in man page (#676824)- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- updated QoS patch, including upstream comments and AF_INET6 4-in-6 support- add QoS support, patch from Philip Prindeville upstream reserved option ID 0xe7 for testing of this new feature (#576643)- change LSB init header to provide $mail-transport-agent (#627413)- fix m4 ldap routing macro, backport from 8.14.5.Alpha0, (#650366)- Rebuilt for gcc bug 634757- fix MAXHOSTNAMELEN (#485380)- rebuilt with libdb-5.1- updated sendmail.nm-dispatcher script to handle VPN connections (#577540)- README.libmilter moved to milter subpackage - updated description of doc subpackage - README.redhat removed (not needed any more)- added stub man pages for hoststat and purgestat - rmail man page added to alternatives - updated subpackages description - sendmail-cf/cf/README is not packaged - it is useless for end users - added comments about purpose of files and patches - removed redundant license tag from milter subpackage- added license to milter subpackage according to new Licensing Guidelines- all 'define' changed to 'global' in spec - perl interpreter path fixup moved from 'install' to 'prep'- silenced warning about non-existing config in {_libdir}/sasl2- sasl2 config moved froxșX<UP^a$<aaa368ce75a62cd74acbcb66f240b5bf456e618186cd5762c66e7be78339bb6a469c45d2be5c563e0b2d872feaac670db01a1c9c9fe687bad0dc0e26cb7a7959c8abeea981818a9b8df654745ad85b3ec76b08adc98d4c514f569d6fa5fac389ef4cfe68ad0ce5a8edcd2e17292358d274eb9c59f0ac7e47d347c25de3e2ecf98429274027cd4a26071830ba8c4db9a4e32d34d5bbf814fe7d4a38dc0e89d9712018cd28c1a36b25953b2c538e9f79a4e32d34d5bbf814fe7d4a38dc0e89d9712018cd28c1a36b25953b2c538e9f762cabbe1bb26c27b69abb7739304c00fb2072ab917cbaeaf2653ec855c20541201225cee5dbed90d9d8f0cebd314987ee12e15c8ee68977602ba8d8e07b8691701225cee5dbed90d9d8f0cebd314987ee12e15c8ee68977602ba8d8e07b8691797565ac26db1f36a2a3ae186b4265113be848fdf2c3251d0c2ef5f64b2b946b09b14b30fa144bffd1dfef5e12ffe739e79a8bb8aa9171f0dac53ed01d2c1f3309b14b30fa144bffd1dfef5e12ffe739e79a8bb8aa9171f0dac53ed01d2c1f33085cb6528a594c8dd04a28771838c9240712a0114ee90e2d1e0be4ae5ce8f5bd9d0e99c8bd47d9def2934a1f27ebf0ba9f5cc9d8075f2327115015dc49a087fead0e99c8bd47d9def2934a1f27ebf0ba9f5cc9d8075f2327115015dc49a087feaeea4388a21b8183811ce33f3cf39a0f6975bcb7e4cb6deb134e3accaa1e7206673a1bad6231afe59e373a38e0c37b1c0e681a1d34dfb0cbd9caedccf33579ff273a1bad6231afe59e373a38e0c37b1c0e681a1d34dfb0cbd9caedccf33579ff2a315c1f1b697a89bf6f581b8d1a092f545e4f7339bca83a3c9af0127b35d0493b6d13c1cf665e2257bb3e415a208db1f4e358b12c86fa9202f55ad368543c303b6d13c1cf665e2257bb3e415a208db1f4e358b12c86fa9202f55ad368543c3039761173c0154ddf02c662809c541fac7ae81ee384d681d3bebe2f9151eb5ed1f048e28fb21523737cfeb36cd98cc259f829ec55487b0ed09ef9bc3ad5d9017df048e28fb21523737cfeb36cd98cc259f829ec55487b0ed09ef9bc3ad5d9017df2e689443f7fa3570c8cfabfab033e4a135a5fb665c732ecfa597d0298b6c71a7b18eba71dfbbf5e5e9262ec5283cc09af372f1b9974ec45640883ddacc9f86b9b18eba71dfbbf5e5e9262ec5283cc09af372f1b9974ec45640883ddacc9f86b932c016ebd5e9fdfa94a38c4e0ee7dc28ce8065ffa8cc76b3e3858f65db0314909a199575138372ce529b7131c586dc9f3146f137c6901f2f0c03052f141d45289a199575138372ce529b7131c586dc9f3146f137c6901f2f0c03052f141d452873c65151df1f7efcaf18a18682f7b934a73c55db405aabaef3ee059ced8476f0c25a9f0102dd8d522c4021a972ba7ffebfd807ecbb40c11e0bf17a25152e33d6c25a9f0102dd8d522c4021a972ba7ffebfd807ecbb40c11e0bf17a25152e33d65bdc21fc6bb78c300c2215415756670a427060b1d193fbffb2efc72c02c191944d113131a8c15226165a7d270726b95550995cb4ca2ba66245e5de76b301ac014d113131a8c15226165a7d270726b95550995cb4ca2ba66245e5de76b301ac01af063b2f80593053e5ae9fe2e93d949f8fe2298c27ad727ec95e8525937c603a0c576d24edb344f5f34eac5578fd62a63d06b9b0921bfde168b2c0698471ecd10c576d24edb344f5f34eac5578fd62a63d06b9b0921bfde168b2c0698471ecd1e2c8e32a2ca579c25e2fd75afd1681663772997da3b4cb3ce2803d942a9be148db09d8ec13951d3ed6d5f34221973c261b1cb51493627ab376cd6bf1b35393f3db09d8ec13951d3ed6d5f34221973c261b1cb51493627ab376cd6bf1b35393f338a43e4df5209acff66e76519f886b7252c3a223768be1d259c8ecdc10b6898f92d70488de045555a7cec0d9941c628c4fa99ff0df1edce82c1a2d1fdc05e0c792d70488de045555a7cec0d9941c628c4fa99ff0df1edce82c1a2d1fdc05e0c74cdcb6dbab826e58e353e0e3015a3b8fb11f7db8f9cf15ef0e1d127577a16f39f74ddf10eb08741b425b04a35e7c8962673e7d8504a9fd36c353748b383e670ef74ddf10eb08741b425b04a35e7c8962673e7d8504a9fd36c353748b383e670e6375232d720c48ec598205edbd9b9c13dcafe2d90a66d55a9f8e73f1e8b1e2c5e5af3ffe092eb47483bfa1df2172288fae0260dee59e074f4b3bdad7bda870a1e5af3ffe092eb47483bfa1df2172288fae0260dee59e074f4b3bdad7bda870a1fd592f4070b651c2206453d1ae8897fcfd05b3b1cda92ffaf5f951d3ea2ad81fb9865ef0c1e806f0b5dbafdb16c23bdcb31f3bf68005b26c186732ae02fa2ba1b9865ef0c1e806f0b5dbafdb16c23bdcb31f3bf68005b26c186732ae02fa2ba11ca7638ed3b71323fd10a8b51e0c61fde514eb2090d1f057f4d3779fecdbf0919ab14c056743da8a5d9367eb608239eccb6bbd805aef4e60cc001dd5098cecda9ab14c056743da8a5d9367eb608239eccb6bbd805aef4e60cc001dd5098cecda5e809212967641a3a0a368759bcd065bb354823fdbf7704ab5b72ec20b6768aa4f2aaa873b2c3156c7dedf98ea0a9e0fd4dc4811d6d8e04259fd5de57f99af324f2aaa873b2c3156c7dedf98ea0a9e0fd4dc4811d6d8e04259fd5de57f99af323859eb7b2a3fd581c3065e58526f600b32a53753078166df490019565b368da31cb8b6a0cea45865ea62b1398c757147c6e738327707a917791ff52b27a16acd1cb8b6a0cex@X=W $ Bd?d  ^PTlpw  $  6  H  l       >d (8 9 : U G  H 8 I \ X hY t\ ] ^ b d e f l t u v wL xp y   HL Xg\h`Cperl-Data-Dumper2.1453.el7Stringify perl data structures, suitable for printing and evalGiven a list of scalars or reference variables, writes out their contents in perl syntax. The references can also be objects. The content of each variable is output in a single Perl statement. Handles self-referential structures correctly.S worker1.bsys.centos.orgCentOSGPL+ or ArtisticCentOS BuildSystem Development/Librarieshttp://search.cpan.org/dist/Data-Dumper/linuxx86_64VX"<%A큤AAA큤S QBS S S S QB~NS ef4e2cdf008d49e50122b136f6389d29338c2cfbcf628246c064f401bf2643a663d5bc0299fb9d2cb2ed0364d65c6d0476aebee7d6541d61cecd10518d5a36f654cb516714d74178d3848bcf6eae54fd3007947d8ca24e5650afcb40b034f395d782ecc8442ceb1b1639b645f95a76c5fd9c219d115189e36fd69bf5139442c316e31f0764a75ca49af373ad1f38027fed80b50d8626bdf04618a9d92da371a9rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-Data-Dumper-2.145-3.el7.src.rpmperl(Data::Dumper)perl-Data-Dumperperl-Data-Dumper(x86-64)@@@@@@ @@@@   @ libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)perlperl(:MODULE_COMPAT_5.16.3)perl(B::Deparse)perl(Carp)perl(Exporter)perl(Scalar::Util)perl(XSLoader)perl(bytes)perl(constant)perl(overload)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)0:5.006_0013.0.4-14.6.0-14.0-15.2-14.11.1RURkQGQ/FQPqPnP7lP(@P H@OF@O Daniel Mach - 2.145-3Daniel Mach - 2.145-2Petr Pisar - 2.145-1Petr Pisar - 2.143-1Fedora Release Engineering - 2.139-2Petr Pisar - 2.139-1Petr Pisar - 2.136-1Petr Pisar - 2.135.07-241Marcela Mašláňová - 2.135.07-240Fedora Release Engineering - 2.131-3Petr Pisar - 2.131-2Petr Pisar 2.131-1- Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- 2.145 bump- 2.143 bump- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- 2.139 bump- 2.136 bump- Disable tests on bootstrap- update the version to override the module from perl.srpm - bump release to override sub-package from perl.spec- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Perl 5.16 rebuild- Specfile autogenerated by cpanspec 1.78. 2.1452.145-3.el72.145-3.el7DataDxxX>8Xh$thentication (WL#1054) plugin binaries- With a recent spec file cleanup, names have changed: A "-community" part was dropped. Reflect that in the "Obsoletes" specifications. - Add a "triggerpostun" to handle the uninstall of the "-community" server RPM. - This fixes bug#55015 "MySQL server is not restarted properly after RPM upgrade".- Change the behaviour on installation and upgrade: On installation, do not autostart the server. *Iff* the server was stopped before the upgrade is started, this is taken as a sign the administrator is handling that manually, and so the new server will not be started automatically at the end of the upgrade. The start/stop scripts will still be installed, so the server will be started on the next machine boot. This is the 5.5 version of fixing bug#27072 (RPM autostarting the server).- Implement SELinux checks from distribution-specific spec file.- Large number of changes to build using CMake - Introduce distribution-specific RPMs - Drop debuginfo, build all binaries with debug/symbols - Remove __os_install_post, use native macro - Remove _unpackaged_files_terminate_build, make it an error to have unpackaged files - Remove cluster RPMs- Add "--with-perfschema" to the configure options.- User "usr/lib*" to allow for both "usr/lib" and "usr/lib64", mask "rmdir" return code 1. - Remove "ha_example.*" files from the list, they aren't built.- Fix a wrong path name in handling the debug plugins.- Take the result of the debug plugin build and put it into the optimized tree, so that it becomes part of the final installation; include the files in the packlist. Part of the fixes for bug#49022.- Set "Oracle and/or its affiliates" as the vendor and copyright owner, accept upgrading from packages showing MySQL or Sun as vendor.- Formatting changes: Have a consistent structure of separator lines and of indentation (8 leading blanks => tab). - Introduce the variable "src_dir". - Give the environment variables "MYSQL_BUILD_CC(CXX)" precedence over "CC" ("CXX"). - Drop the old "with_static" argument analysis, this is not supported in 5.1 since ages. - Introduce variables to control the handlers individually, as well as other options. - Use the new "--with-plugin" notation for the table handlers. - Drop handling "/etc/rc.d/init.d/mysql", the switch to "/etc/init.d/mysql" was done back in 2002 already. - Make "--with-zlib-dir=bundled" the default, add an option to disable it. - Add missing manual pages to the file list. - Improve the runtime check for "libgcc.a", protect it against being tried with the Intel compiler "icc".- Change RPM file naming: - Suffix like "-m2", "-rc" becomes part of version as "_m2", "_rc". - Release counts from 1, not 0.- The "semisync" plugin file name has lost its introductory "lib", adapt the file lists for the subpackages. This is a part missing from the fix for bug#48351. - Remove the "fix_privilege_tables" manual, it does not exist in 5.5 (and likely, the whole script will go, too).- remove erroneous traces of the InnoDB plugin (that is 5.1 only).- Removed mysql_fix_privilege_tables- "mysqlmanager" got removed from version 5.4, all references deleted.- Merge up from 5.1 to 5.4: Remove handling for the InnoDB plugin.- This version does not contain the "Instance manager", "mysqlmanager": Remove it from the spec file so that packaging succeeds.- Add conditionals for bundled zlib and innodb plugin- Install plugin libraries in appropriate packages. - Disable libdaemon_example and ftexample plugins.- Update variable used for mysql-test suite location to match source.- Correct yesterday's fix, so that it also works for the last flag, and fix a wrong quoting: un-quoted quote marks must not be escaped.- Removed "mysql_upgrade_shell" - Removed some copy/paste between debug and normal build- Modify CFLAGS and CXXFLAGS such that a debug build is not optimized. This should cover both gcc and icc flags. Fixes bug#40546.- Removed the "Federated" storage engine option, and enabled in all- x0hX?bWby$iyzxcking CVE-2013-7345- gd: fix NULL deref in imagecrop CVE-2013-7327 - gd: drop vpx support, fix huge memory consumption #1075201- fix patch name - fix memory leak introduce in patch for CVE-2014-1943 - fix heap-based buffer over-read in DateInterval CVE-2013-6712- fix infinite recursion in fileinfo CVE-2014-1943- fix heap overflow vulnerability in imagecrop CVE-2013-7226- allow multiple paths in ini_scan_dir #1058161- add security fix for CVE-2013-6420- rebuild with test enabled - add dependency on php-pecl-jsonc- update to PHP 5.5.6 - buildstrap build- update to PHP 5.5.5 - mod_php only for httpd24- update to PHP 5.5.4 - improve security, use specific soap.wsdl_cache_dir use /var/lib/php/wsdlcache for mod_php and php-fpm - sync short_tag comments in php.ini with upstream - relocate RPM macro- update to PHP 5.5.3 - improve system libzip patch - fix typo and add missing entries in php.ini- update to PHP 5.5.1 for php55 SCL- rebuild for new httpd-mmn value- remove ZTS conditional stuf for ligibility - add mod_php for apache 2.4 (from httpd24 collection)- improve mod_php, pgsql and ldap description - add missing man pages (phar, php-cgi) - add provides php(pdo-abi) for consistency with php(api) and php(zend-abi) - use %__isa_bits instead of %__isa in ABI suffix #985350- add security fix for CVE-2013-4113 - add missing ASL 1.0 license- run tests during build- rebase to 5.4.16 - fix hang in FindTishriMolad(), #965144 - patch for upstream Bug #64915 error_log ignored when daemonize=0 - patch for upstream Bug #64949 Buffer overflow in _pdo_pgsql_error, #969103 - patch for upstream bug #64960 Segfault in gc_zval_possible_root- remove wrappers in /usr/bin (#966407)- rebuild for libjpeg (instead of libjpeg_turbo) - fix unowned dir %{_datadir}/fpm and %{_libdir}/httpd (#956221)- update to 5.4.14 - clean old deprecated options- update to 5.4.13 - security fixes for CVE-2013-1635 and CVE-2013-1643 - make php-mysql package optional (and disabled) - make ZTS build optional (and disabled) - always try to load mod_php (apache warning is usefull) - Hardened build (links with -z now option) - Remove %config from /etc/rpm/macros.php- update to 5.4.11 - fix php.conf to allow MultiViews managed by php scripts- update to 5.4.10 - remove patches merged upstream - drop "Configure Command" from phpinfo output - prevent php_config.h changes across (otherwise identical) rebuilds- update to 5.4.9- fix php.conf- filter private shared in _httpd_modir - improve system libzip patch to use pkg-config - use _httpd_contentdir macro and fix php.gif path - switch back to upstream generated scanner/parser - use system pcre only when recent enough- improves php.conf, no need to be relocated- clarify Licenses - missing provides xmlreader and xmlwriter - change php embedded library soname version to 5.4- fix mysql_sock macro definition- fix standard build (non scl)- fix installed headers- use libldap_r for ldap extension- add missing scl_prefix in some provides/requires- make php-enchant optionnal, not available on RHEL-5 - make php-recode optionnal, not available on RHEL-5 - disable t1lib on RHEL-5- enable tidy on RHEL-6 only - re-enable unit tests- minor macro fixes for RHEL-5 build - update autotools workaround for RHEL-5 - use readline when libedit not available (RHEL-5)- update to 5.4.8 - define both session.save_handler and session.save_path - fix possible segfault in libxml (#828526) - use SKIP_ONLINE_TEST during make test - php-devel requires pcre-devel and php-cli (instead of php) - provides php-phar - update systzdata patch to v10, timezone are case insensitive- php-fpm: create apache user if needed - php-cli: provides cli command in standard root (scl)- add configtest option to init script - test configuration before service reload - fix php-fpm service relocation - fix php-fpm config relocation - drop embdded subpackage for scl- missing requires on scl-runtime - relocate /var/lib/session - fix php-devel requires - rename, but don't relocate macros.php- initial spec rewrite for sclxWX@T`u|}$l|}}} just centos as well- Trial run for CentOS DateStamp release - Add stubs for the yum repos - fix os-release to only have one ID_LIKE ( Avij #7171) - make the yum repo definitions be config noreplace ( Trevor )- rebuild for 2014-06-17 pub qa release - ensure we get the right cpe info - ensure centos-release is trackable- prep for public QA release tag as broken- initial setup for centos-rc 7-9.2009.2.el7.centos7.97-9.2009.2.el7.centos7-9.2009.2.el7.centos7.9-47.9-47 centos-releasecentos-release-upstreamissueissue.netos-releaserpm-gpgRPM-GPG-KEY-CentOS-7RPM-GPG-KEY-CentOS-Debug-7RPM-GPG-KEY-CentOS-Testing-7redhat-releasemacros.distsystem-releasesystem-release-cpeCentOS-Base.repoCentOS-CR.repoCentOS-Debuginfo.repoCentOS-Media.repoCentOS-Sources.repoCentOS-Vault.repoCentOS-fasttrack.repoCentOS-x86_64-kernel.repocontentdirinfraos-release85-display-manager.preset90-default.presetEULAContributorsGPLredhat-releaseredhat-release/etc//etc/pki//etc/pki/rpm-gpg//etc/rpm//etc/yum.repos.d//etc/yum/vars//usr/lib//usr/lib/systemd/system-preset//usr/share/centos-release//usr/share/doc/centos-release//usr/share/doc//usr/share/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuASCII textdirectoryUTF-8 Unicode text?e fOPU $ƨ+UW{f9K }H.r0@'ĺ;W];"ek090F| 3-h@"+Z?|0YDY]PN}i81x[e"UҶ4< qZ-n"=co77faN|5U-Eu|ڠ*tVb.tcbHD~L1]!4_o.m [nVoyހ;t\@0`la6(U8KF4@Mk Yֿ }exSۻF ]day4QMU-'` [$ډfOPU $ƨ>2yۋ_UKVZ&ggS.W`q91nS]/ZmC͌;C7t)0V[!?Պ] ֞>ɮxX~;k~m6x rhr~(e䒼,Ek)am6@~, 򥛂9~ 5<03d%uU~-)p G]HYɝ B ƒSVy)sQq[Z犳$C큁4p]RGI9b#A{?b ͭoݪ}ӯv7MM u_qrّ#Մh1Ϗnj&f@G廤pCRˍ~#b`tjC_؎(C_%sh.3b>8riAv֖篧]P4MNz;50d53f747dc5d48a3b782e2e151fc5762b901051g ug u04] - [powerpc] cxl: Add timeout to process element commands (Gustavo Duarte) [1223004] - [powerpc] cxl: Change contexts_lock to a mutex to fix sleep while atomic bug (Gustavo Duarte) [1223004] - [powerpc] mm: don't do tlbie for updatepp request with NO HPTE fault (Gustavo Duarte) [1223004] - [powerpc] cxl: Name interrupts in /proc/interrupt (Gustavo Duarte) [1223004] - [powerpc] cxl: Return error to PSL if IRQ demultiplexing fails & print clearer warning (Gustavo Duarte) [1223004] - [powerpc] cxl: Fix PSL error x GXAVXP$ D?ld  x| $D T d    (Hp D > (a8h9: ?>@GH4ITX\Yh\]^bAdefltuv<wx0yPh|  ghCfrqrencode-libs3.4.13.el7QR Code encoding library - Shared librariesBibliothèque d'encodage QR Code - Bibliothèque partagéeThe qrencode-libs package contains the shared libraries and header files for applications that use qrencode.Le paquet qrencode-libs contient les bibliothèques partagées et les fichiers d'en-tête pour les applications utilisant qrencode.Sworker1.bsys.centos.org CentOSLGPLv2+CentOS BuildSystem Unspecifiedhttp://megaui.net/fukuchi/works/qrencode/index.en.htmllinuxx86_64Ѹg}$QA큤SSSLNP~P~P{0Ovv65ce378e2dff7aec5be67af4d6d5434ab99864796c51d7be06ad66beb63d93755a9bdde5616ecdd1e980b44f360600ee8783b1f99b8cc83a2beb163a0a390e861b0d626d0be74d5bdc63906c3f71e2d88649b08b276478aef7232f0a4a55c0d10aaf80119f209d83745e522b1f4e3469e985699a9d4b1618a9c58b39bd69ffe2e14ecebf89ac856ff61190c22e12b3f654293133747d702b4702d2eb468a3e2503523e9fab88fbb694ea6015e429154dfd14375eb5f9fe82a323cec78af83c307libqrencode.so.3.4.1rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootqrencode-3.4.1-3.el7.src.rpmlibqrencode.so.3()(64bit)qrencode-libsqrencode-libs(x86-64)@@@@   @ /sbin/ldconfig/sbin/ldconfiglibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.1RURkQsP\VP,P OOH@OF*@OOn@NMQ0@L - 3.4.1-3Daniel Mach - 3.4.1-2Matthieu Saulnier - 3.4.1-1Matthieu Saulnier - 3.3.1-4Matthieu Saulnier - 3.3.1-3Fedora Release Engineering - 3.3.1-2Matthieu Saulnier - 3.3.1-1Peter Gordon - 3.2.0-3Peter Gordon - 3.2.0-2Matthieu Saulnier - 3.2.0-1Fedora Release Engineering - 3.1.1-7Adam Jackson - 3.1.1-6Fedora Release Engineering - 3.1.1-5Tareq Al Jurf - 3.1.1-4Tareq Al Jurf - 3.1.1-3Tareq Al Jurf - 3.1.1-2Tareq Al Jurf - 3.1.1-1- Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- Update to 3.4.1- Add libs subpackage (fix RHBZ #856808)- Add French translation in spec file - Fix incomplete removing Group tags in spec file- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- update to 3.3.1 - remove "Group" tag in spec file - fix manfile suffix - remove pax6XBX@ A$org> 5.6.5-0.1.RC1Remi Collet 5.6.4-2Remi Collet 5.6.4-1Remi Collet 5.6.4-0.1.RC1Remi Collet 5.6.3-3Remi Collet 5.6.3-2Remi Collet 5.6.3-1Remi Collet 5.6.3-0.1.RC1Remi Collet 5.6.2-1Remi Collet 5.6.1-1Remi Collet 5.6.0-1.1Remi Collet 5.6.0-1Remi Collet - 5.6.0-0.1.RC4Remi Collet - 5.5.6-10Remi Collet - 5.5.6-9Remi Collet - 5.5.6-8Remi Collet - 5.5.6-7Remi Collet - 5.5.6-6Remi Collet - 5.5.6-5Remi Collet - 5.5.6-4Remi Collet 5.5.6-2Remi Collet 5.5.6-0Remi Collet 5.5.5-1Remi Collet 5.5.4-1Remi Collet 5.5.3-1Remi Collet 5.5.1-1Remi Collet 5.4.16-6Remi Collet 5.4.16-5Remi Collet 5.4.16-4Remi Collet - 5.4.16-3Remi Collet 5.4.16-2Remi Collet 5.4.16-1Remi Collet 5.4.14-3Remi Collet 5.4.14-2Remi Collet 5.4.14-1Remi Collet 5.4.13-1Remi Collet 5.4.11-1Remi Collet 5.4.10-1Remi Collet 5.4.9-1Remi Collet 5.4.8-7Remi Collet 5.4.8-6Remi Collet 5.4.8-5Remi Collet 5.4.8-6Remi Collet 5.4.8-4Remi Collet 5.4.8-4Remi Collet 5.4.8-3Joe Orton - 5.4.8-2Remi Collet 5.4.8-3Remi Collet 5.4.8-2.1Remi Collet 5.4.8-2Remi Collet 5.4.8-1.2Remi Collet 5.4.8-1Remi Collet 5.4.7-4Remi Collet 5.4.7-3Remi Collet 5.4.7-2Remi Collet 5.4.7-1Remi Collet 5.4.7-10Remi Collet 5.4.7-9Remi Collet 5.4.7-8Remi Collet 5.4.7-7Remi Collet 5.4.7-6Remi Collet 5.4.7-5Remi Collet 5.4.7-4Remi Collet 5.4.7-3Remi Collet 5.4.7-2Remi Collet 5.4.7-1Remi Collet 5.4.6-2Remi Collet 5.4.6-1Remi Collet 5.4.5-1Remi Collet 5.4.4-4Remi Collet 5.4.4-3Remi Collet 5.4.4-2Remi Collet 5.4.4-1Remi Collet 5.4.3-1Remi Collet 5.4.2-1Remi Collet 5.4.1-1Joe Orton - 5.4.0-6Remi Collet 5.4.0-5Joe Orton - 5.4.0-4Joe Orton - 5.4.0-3Joe Orton - 5.4.0-2Remi Collet 5.4.0-1Remi Collet 5.4.0-0.4.RC8Remi Collet 5.4.0-0.3.RC7Remi Collet 5.4.0-0.2.RC6Remi Collet 5.4.0-0.1.RC6Remi Collet 5.3.8-4.4Remi Collet 5.3.8-4.3Adam Jackson - 5.3.8-4.2Marcela Mašláňová - 5.3.8-3.2Peter Schiffer - 5.3.8-3.1Remi Collet 5.3.8-3Remi Collet 5.3.8-2Remi Collet - 1:0.7.0-2.git20090207Dan Williams - 1:0.7.0-1.git20090102Dan Williams - 1:0.7.0-0.12.svn4326Dan Williams - 1:0.7.0-0.12.svn4296Dan Williams - 1:0.7.0-0.12.svn4295Dan Williams - 1:0.7.0-0.12.svn4293Dan Williams - 1:0.7.0-0.11.svn4229Dan Williams - 1:0.7.0-0.11.svn4201Dan Williams - 1:0.7.0-0.11.svn4175Dan Williams - 1:0.7.0-0.11.svn4174Dan Williams - 1:0.7.0-0.11.svn4022.4Dan Williams - 1:0.7.0-0.11.svn4022.3Dan Williams - 1:0.7.0-0.11.svn4022.2Dan Williams - 1:0.7.0-0.11.svn4022.1Dan Williams - 1:0.7.0-0.11.svn4022Dan Williams - 1:0.7.0-0.11.svn3930Dan Williams - 1:0.7.0-0.11.svn3927Dan Williams - 1:0.7.0-0.11.svn3846Dan Williams - 1:0.7.0-0.11.svn3830Matthias Clasen - 1:0.7.0-0.10.svn3801Dan Williams - 1:0.7.0-0.10.svn3801Dan Williams - 1:0.7.0-0.10.svn3747Dan Williams - 1:0.7.0-0.9.4.svn3675Dan Williams - 1:0.7.0-0.9.3.svn3675Dan Williams - 1:0.7.0-0.9.3.svn3669Dan Williams - 1:0.7.0-0.9.3.svn3667Dan Williams - 1:0.7.0-0.9.3.svn3665Dan Williams - 1:0.7.0-0.9.3.svn3623Dan Williams - 1:0.7.0-0.9.2.svn3623Dan Williams - 1:0.7.0-0.9.2.svn3622Dan Williams - 1:0.7.0-0.9.2.svn3620Dan Williams - 1:0.7.0-0.9.2.svn3619Dan Williams - 1:0.7.0-0.9.2.svn3614Dan Williams - 1:0.7.0-0.9.2.svn3590Dan Williams - 1:0.7.0-0.9.2.svn3578Dan Williams - 1:0.7.0-0.9.2.svn3571Dan Williams - 1:0.7.0-0.9.2.svn3570Dan Williams - 1:0.7.0-0.9.2.svn3566Dan Williams - 1:0.7.0-0.9.1.svn3566Dan Williams - 1:0.7.0-0.9.1.svn3549Dan Williams - 1:0.7.0-0.9.1.svn3548Dan Williams - 1:0.7.0-0.9.1.svn3547Dan Williams - 1:0.7.0-0.9.1.svn3527Dan Williams - 1:0.7.0-0.9.1.svn3521Dan Williams - 1:0.7.0-0.9.1.svn3476Dan Williams - 1:0.7.0-0.9.1.svn3473Dan Williams - 1:0.7.0-0.9.1.svn3472Dan Williams - 1:0.7.0-0.9.1.svn3440Dan Williams - 1:0.7.0-0.9.1.svn3417Dan Williams - 1:0.7.0-0.8.svn3417Dan Williams - 1:0.7.0-0.8.svn3370Dan Williams - 1:0.7.0-0.8.svn3369Dan Williams - 1:0.7.0-0.8.svn3319Dan Williams - 1:0.7.0-0.8.svn3312Dan Williams - 1:0.7.0-0.8.svn3302Dan Williams - 1:0.7.0-0.8.svn3261Dan Williams - 1:0.7.0-0.8.svn3235Dan Williams - 1:0.7.0-0.8.svn3204Dan Williams - 1:0.7.0-0.8.svn3181Dan Williams - 1:0.7.0-0.8.svn3180Dan Williams - 1:0.7.0-0.8.svn3138Dan Williams - 1:0.7.0-0.8.svn3134Dan Williams - 1:0.7.0-0.8.svn3133Jeremy Katz - 1:0.7.0-0.8.svn3109Dan Williams - 1:0.7.0-0.6.6.svn3109Dan Williams - 1:0.7.0-0.6.5.svn3109Dan Williams - 1:0.7.0-0.6.5.svn3096Dan Williams - 1:0.7.0-0.6.4.svn3096Dan Williams - 1:0.7.0-0.6.3.svn3096Dan Williams - 1:0.7.0-0.6.3.svn3094Dan Williams - 1:0.7.0-0.6.2.svn3080Dan Williams - 1:0.7.0-0.6.1.svn3030Dan Williams - 1:0.7.0-0.5.svn3030Dan Williams - 1:0.7.0-0.4.svn3030Dan Williams - 1:0.7.0-0.4.svn3020Dan WillixXEWXX$HXYWootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootfreetype-2.8-14.el7_9.1.src.rpmfreetype-develfreetype-devel(x86-64)pkgconfig(freetype2)@@@@@    /bin/sh/usr/bin/pkg-configfreetypelibfreetype.so.6()(64bit)pkgconfig(libpng)pkgconfig(x86-64)pkgconfig(zlib)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)2.8-14.el7_9.13.0.4-14.6.0-14.0-15.2-14.11.3_@\M[[o[@[X@X@XV3TSRURkRM\@QQ@Q@QHS@Q@P!@P@POjOu@ONT@N@N @N:N&@N @Mv@Ma@MQ0@L@L LLdL[@L[@K@K@JI@J@Jq@Ji@J@I̿IIJII@Io%@I>]I9H@HNlH4Gs@FvF$@F;@F@F^F@FFFEL@E'EEEEOE D,@DDDZ@D@DȪD@DLDLDk@C@CCqC}@CgXCX@CLCFc@C@B@B(MA@@@@O@@Dw@@,@@ ?p5?3? @>>v>@>̻>[Z>K>?@>.>o>)=z@=@==@=V=l@=S==E@=*@=)~="@= D@=@=@=<@<<@<@ - 2.8-14.el7_9.1Marek Kasik - 2.8-14Marek Kasik - 2.8-13Marek Kasik - 2.8-12Marek Kasik - 2.8-11Richard Hughes - 2.8-10Marek Kasik - 2.4.11-15Marek Kasik - 2.4.11-14Marek Kasik - 2.4.11-13Marek Kasik - 2.4.11-12Marek Kasik - 2.4.11-11Peter Robinson - 2.4.11-10Daniel Mach - 2.4.11-9Daniel Mach - 2.4.11-8Marek Kasik - 2.4.11-7Peter Robinson 2.4.11-6Marek Kasik - 2.4.11-5Marek Kasik - 2.4.11-4Marek Kasik - 2.4.11-3Fedora Release Engineering - 2.4.11-2Marek Kasik - 2.4.11-1Marek Kasik - 2.4.10-3Fedora Release Engineering - 2.4.10-2Marek Kasik 2.4.10-1Marek Kasik 2.4.9-1Fedora Release Engineering - 2.4.8-2Marek Kasik 2.4.8-1Fedora Release Engineering - 2.4.7-2Marek Kasik 2.4.7-1Marek Kasik 2.4.6-1Marek Kasik 2.4.5-2Marek Kasik 2.4.5-1Marek Kasik 2.4.4-4Marek Kasik 2.4.4-3Fedora Release Engineering - 2.4.4-2Marek Kasik 2.4.4-1Marek Kasik 2.4.3-2Marek Kasik 2.4.3-1Marek Kasik 2.4.2-3Matthias Clasen 2.4.2-2Matthias Clasen 2.4.2-1Behdad Esfahbod 2.3.12-1Behdad Esfahbod 2.3.11-2Behdad Esfahbod 2.3.11-1Behdad Esfahbod 2.3.10-1Behdad Esfahbod 2.3.9-6Fedora Release Engineering - 2.3.9xxXFVi\$L\]B>?9d  H#+ Wm , \  T l D   D d  -( W8 `P9 P:PG3H40I4X4Y4\4]5(^6^b6d7e7f7l7t7u8v8xw8x9Hy99::< <, >D>p>t>g>h>Cpython-urlgrabber3.1010.el7A high-level cross-protocol url-grabberA high-level cross-protocol url-grabber for python supporting HTTP, FTP and file locations. Features include keepalive, byte ranges, throttling, authentication, proxies and more.^ x86-01.bsys.centos.org>CentOSLGPLv2+CentOS BuildSystem Development/Librarieshttp://urlgrabber.baseurl.org/linuxnoarch0 :B@A?y GFMGRGRut +$_E$A큤A큤^ ^ ^ RUI ^ ^ R]y^ ^ ^ ^ ^ R]y^ ^ REf^ ^ R^ RUJQ8R]yQ8e999332f2f03964406c5405df1a55e7f94fa14b01c8666790b2ddfe95c21c811bebb48df47532f41203bf1e6f96456dcacec0102db3ba6dff10bf44c96fd7b2f420629991c7146581a7d23b62c68c90653948fd31dd00d9bef4bd7d257a41f341152df1c75ade9320e134e3d1cdf132e269100fa73ddceae29bd0d8a8f3324911152df1c75ade9320e134e3d1cdf132e269100fa73ddceae29bd0d8a8f332491e253d971beb79a8ecc4746122df644e0f334f9b34fec71211e421653cca0d5466fc7658eaf3aa7861e32c1b2e3366ed55adaaf36baab96bf4346486ba336d5c218f487ba34e0c723894dde30889e76f37191a6191b01f77f5e58e73833c3e59de93bd35eb4481b489714ab64e18aad7bb7e7d23356745e6712e7a50d1acaa322a74e836e4a0af01c7db58242913ba9c8d1ae0d49418141f244c79cd1cc3e6f8df2f76fed102d8d06bd474b070afb725df2ab27afba7d84a4b5cbd929fa94e046def9dac31be71d35f4602b92624e7f2664bfa3cafc761ced73167484e164a80f49e17c9ec965afa33725480df91002662697878c0c49ea8d37e1c528b0e5613749e17c9ec965afa33725480df91002662697878c0c49ea8d37e1c528b0e561379ab89416fbcb8721966780b19c89a6a92af8c5139e00fd0c573d71c73fa0ca152afd34c6e02e8ee9ffc49a547c150e424c8d72b3b115666b013562a5579a3c676f7f412a40b8e21664e64c7a74e1aa4c436306bfdbb320c42fd3adf84543c745bcd176185dc82e8c753825b4d1acfa3dd18c6254e7af6811a49e79efc5690c80a6eb4c37f8ec17f12a773d8f9d5756b55fc59f1c739c21aa8947ff4a70a53c4feea173a556abac0370461e57e12aab266894ea6be3874c2be05fd87871f7544947adbf6d5848965d9f0d554bed9ed3dbba48d4293913fc9d6d1b99e06475c6acff0a5bc743e4e5912830e21128c38a516910c9b2bffb108286be3da576498bc1rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootpython-urlgrabber-3.10-10.el7.src.rpmpython-urlgrabberurlgrabber@@     /usr/bin/pythonpython(abi)python-pycurlrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PartialHardlinkSets)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)2.73.0.4-14.6.0-14.0.4-14.0-15.2-14.11.3]_@[Wu UT"@T=@R@RRkRe@R_@RSRM\@RM\@R7QKQQR@Q8@QPPPd@PExXGW` *$kton - 5.4.0-3Joe Orton - 5.4.0-2Remi Collet 5.4.0-1Remi Collet 5.4.0-0.4.RC8Remi Collet 5.4.0-0.3.RC7Remi Collet 5.4.0-0.2.RC6Remi Collet 5.4.0-0.1.RC6Remi Collet 5.3.8-4.4Remi Collet 5.3.8-4.3Adam Jackson - 5.3.8-4.2Marcela Mašláňová - 5.3.8-3.2Peter Schiffer - 5.3.8-3.1Remi Collet 5.3.8-3Remi Collet 5.3.8-2Remi Collet 5.3.8-1Remi Collet 5.3.7-1Joe Orton - 5.3.6-4Remi Collet 5.3.6-3Remi Collet 5.3.6-2Remi Collet 5.3.6-1Joe Orton - 5.3.5-6Caolán McNamara 5.3.5-5Remi Collet 5.3.5-4Remi Collet 5.3.5-3Fedora Release Engineering - 5.3.5-2Remi Collet 5.3.5-1Remi Collet 5.3.4-2Remi Collet 5.3.4-1.1Remi Collet 5.3.4-1Remi Collet 5.3.3-5Joe Orton - 5.3.3-4Joe Orton - 5.3.3-3Remi Collet 5.3.3-2Remi Collet 5.3.3-1Remi Collet 5.3.2-3Caolán McNamara 5.3.2-2Remi Collet 5.3.2-1Joe Orton - 5.3.1-3Joe Orton - 5.3.1-2Remi Collet 5.3.1-1Tom "spot" Callaway - 5.3.0-7Tomas Mraz - 5.3.0-6Fedora Release Engineering - 5.3.0-5Joe Orton 5.3.0-4Joe Orton 5.3.0-3Joe Orton 5.3.0-2Remi Collet 5.3.0-1Remi Collet 5.2.10-1Remi Collet - 5.2.9-1Fedora Release Engineering - 5.2.8-10Joe Orton 5.2.8-9Joe Orton 5.2.8-8Joe Orton 5.2.8-7Joe Orton 5.2.8-5Joe Orton 5.2.8-4Joe Orton 5.2.8-3Remi Collet 5.2.8-2Remi Collet 5.2.8-1Remi Collet 5.2.7-1.1Remi Collet 5.2.7-1Joe Orton 5.2.6-7Joe Orton 5.2.6-6Remi Collet 5.2.6-5Remi Collet 5.2.6-4Joe Orton 5.2.6-3Joe Orton 5.2.5-7Fedora Release Engineering - 5.2.5-6Joe Orton 5.2.5-5Joe Orton 5.2.5-4Release Engineering - 5.2.5-3Joe Orton 5.2.5-2Joe Orton 5.2.4-3Joe Orton 5.2.4-2Joe Orton 5.2.3-9Joe Orton 5.2.3-8Hans de Goede 5.2.3-7Joe Orton 5.2.3-6Joe Orton 5.2.3-5Joe Orton 5.2.3-4Joe Orton 5.2.3-3Joe Orton 5.2.3-2Joe Orton 5.2.2-4Joe Orton 5.2.2-3Joe Orton 5.2.2-2Joe Orton 5.2.1-5Joe Orton 5.2.1-4Joe Orton 5.2.1-3Joe Orton 5.2.1-2Joe Orton 5.2.0-10Joe Orton 5.2.0-9Joe Orton 5.2.0-8Joe Orton 5.2.0-7Joe Orton - 10.3.8-1Remi Collet - 10.3.7-1Remi Collet - 10.3.6-1Remi Collet - 10.3.5-1Remi Collet - 10.3.4-1Remi Collet - 10.3.2-1Remi Collet - 10.3.1-1Remi Collet - 10.3.0-1Remi Collet - 10.3.0~beta-1Remi Collet - 10.2.7-1Remi Collet - 10.2.5-1Remi Collet - 10.2.4-1Remi Collet - 10.2.3-1Remi Collet - 10.2.2-1Remi Collet - 10.2.1-1Remi Collet - 10.2.0-1Remi Collet - 10.1.1-1Pablo Greco - 10.1.0-2Remi Collet - 10.1.0-1Remi Collet - 10.0.4-1Remi Collet - 10.0.3-1Remi Collet - 10.0.2-1Remi Collet - 10.0.1-1Remi Collet - 10.0.0-2Remi Collet - 10.0.0-1Remi Collet - 6.1.0-1Remi Collet - 6.0.9-1Remi Collet - 6.0.8-1Remi Collet - 6.0.7-1Remi Collet - 6.0.6-1Remi Collet - 6.0.5-1Remi Collet - 6.0.4-1Remi Collet - 6.0.3-1Remi Collet - 6.0.1-1Remi Collet - 5.1.2-1Remi Collet - 5.1.1-1Remi Collet - 5.1.0-1Remi Collet - 5.0.23-1Remi Collet - 5.0.22-1Remi Collet - 5.0.21-1Remi Collet - 5.0.20-1Remi Collet - 5.0.19-1Remi Collet - 5.0.18-1Remi Collet - 5.0.17-1Remi Collet - 5.0.16-1Remi Collet - 5.0.15-1Remi Collet - 5.0.14-1Remi Collet - 5.0.13-1Remi Collet - 5.0.12-1Remi Collet - 5.0.11-1Remi Collet - 5.0.10-1Remi Collet - 5.0.9-1Remi Collet - 5.0.8-1Remi Collet - 5.0.7-1Remi Collet - 5.0.6-1Remi Collet - 5.0.5-1Remi Collet - 5.0.4-1Remi Collet - 5.0.3-1Remi Collet - 5.0.1-1Remi Collet - 4.7.5-2Remi Collet - 4.7.5-1Remi Collet - 4.7.4-1Remi Collet 4.7.3-1.1Remi Collet - 4.7.3-1Remi Collet - 4.7.2-1Remi Collet - 4.7.1-1Remi Collet - 4.7.0-1Remi Collet - 4.6.2-1Remi Collet - 4.6.1-2Remi Collet - 4.6.1-1Remi Collet - 4.6.0-1Remi Collet - 4.5.3-1Remi Collet - 4.5.2-1Remi Collet - 4.5.1-1Remi Collet - 4.4.4-1Remi Collet - 4.4.3-1Remi Collet - 4.4.1-1Remi Collet - 4.2.2-1- update to 13.0.4 (May 31, 2024)- update to 13.0.3 (May 14, 2024) - open https://support.ioncube.com/index.php?/Tickets/Ticket/View/28121 undefined symbol: zend_vspprintf with PHP 7.1- update to 13.0.2 (Sep 11, 2023)- update to 13.0.1 (Aug 25, 2023)- update to 13.0.0 (Aug 24, 2023)- update to 12.0.5 (Dec 22, 2022)- update to 12.0.4 (Dec 9, 2022)- update to 12.0.3 (Dec 2, 2022)- update to 12.0.2 (Sep 9, 2022)- update to 12.0.1 (Aug 12, 2022)- update to 12.0.1 (Aug 8, 2022)- update to 12.0.0 (Aug 5, 2022) - open https://support.ioncube.com/index.php?/Tickets/Ticket/View/25726 [12.0.0] undefined symbol: zend_exXMWă$TăŃÃupdate to 8.0.22RC1- Update to 8.0.21 - http://www.php.net/releases/8_0_21.php - rebuild with new sources- Update to 8.0.21 - http://www.php.net/releases/8_0_21.php- update to 8.0.21RC1- Update to 8.0.20 - http://www.php.net/releases/8_0_20.php- add upstream patch to initialize pcre before mbstring- update to 8.0.20RC1- Update to 8.0.19 - http://www.php.net/releases/8_0_19.php - use oracle client library version 21.6- update to 8.0.19RC1- Update to 8.0.18 - http://www.php.net/releases/8_0_18.php- update to 8.0.18RC1- Update to 8.0.17 - http://www.php.net/releases/8_0_17.php- update to 8.0.17RC1- retrieve tzdata version - use oracle client library version 21.5- Update to 8.0.16 - http://www.php.net/releases/8_0_16.php- update to 8.0.16RC1- Update to 8.0.15 - http://www.php.net/releases/8_0_15.php- update to 8.0.15RC1- Update to 8.0.14 - http://www.php.net/releases/8_0_14.php- ensure we use libgd >= 2.3- update to 8.0.14RC1 - use oracle client library version 21.4- Update to 8.0.13 - http://www.php.net/releases/8_0_13.php- update to 8.0.13RC1- dba: enable qdbm backend- add patch for OpenSSL 3.0 on F36 and EL9- Update to 8.0.12 - http://www.php.net/releases/8_0_12.php- build using system libxcrypt (Fedora)- update to 8.0.12RC1 - use libicu version 69- Update to 8.0.11 - http://www.php.net/releases/8_0_11.php- update to 8.0.11RC1 - use oracle client library version 21.3- Update to 8.0.10 - http://www.php.net/releases/8_0_10.php- phar: switch to sha256 signature by default, backported from 8.1 - phar: implement openssl_256 and openssl_512 for signatures, backported from 8.1 - snmp: add sha256 / sha512 security protocol, backported from 8.1- update to 8.0.10RC1 - adapt systzdata patch for timelib 2020.03 (v20)- add upstream patch for https://bugs.php.net/81325 segfault in simplexml- Update to 8.0.9 - http://www.php.net/releases/8_0_9.php- update to 8.0.9RC1- Update to 8.0.8 - http://www.php.net/releases/8_0_8.php- update to 8.0.8RC1 - ignore unsupported "threads" option on password_hash- Update to 8.0.7 - http://www.php.net/releases/8_0_7.php- update to 8.0.7RC1- get rid of inet_ntoa, inet_aton, inet_addr and gethostbyaddr calls- Update to 8.0.6 - http://www.php.net/releases/8_0_6.php- Update to 8.0.5 - http://www.php.net/releases/8_0_5.php- update to 8.0.5RC1- update to 8.0.4RC1 - use oracle client library version 21.1- Update to 8.0.3 - http://www.php.net/releases/8_0_3.php- update to 8.0.3RC1- Update to 8.0.2 - http://www.php.net/releases/8_0_2.php- add upstream patch for https://bugs.php.net/80682 fix opcache doesn't honour pcre.jit option- update to 8.0.2RC1 - oci8 version is now 3.0.1- Update to 8.0.1 - http://www.php.net/releases/8_0_1.php- test build for new upstream patch (from 8.1)- update to 8.0.1RC1- fix service dependency name - add dependency on make for devel- update to 8.0.0 GA- update to 8.0.0RC5 - use oracle client library version 19.9- update to 8.0.0RC4- update to 8.0.0RC3- update to 8.0.0RC2- update to 8.0.0rc1 - bump ABI/API versions- use %bcond_without for dtrace, libgd, firebird, lsws, libpcre, imap tidy, freetds, sqlite3, enchant so can be disabled during rebuild - use %bcond_with for libgd, libpcre, oci8, and zip so can be enabled during rebuild- update to 8.0.0beta4- update to 8.0.0beta3 - adapt systzdata patch (v19)- build with upstream fix for zend_call_method- update to 8.0.0beta2- use oracle client library version 19.8- update to 8.0.0beta1 - bump ABI/API versions- update to 8.0.0alpha3 - oci8 version is now 3.0.0- rebuild using ICU 65- rebuild 1 upstream patch- update to 8.0.0alpha2 - display build system and provider in phpinfo- add upstream patch to use hash in gen_stub.php- use system nikic/php-parser if available to generate C headers from PHP stub - switch from "runselftest" option to bcond_without tests- update to 8.0.0alpha1- new snapshot- new snapshot - rebuild using oniguruma5php- new snapshot - drop patch to fix PHP_UNAME- new snapshot - drop xmlrpc extension- new snapshot - x(pXN\``i$^iiirootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootpython-certbot-apache-1.11.0-1.el7.src.rpmcertbot-apachepython-certbot-apachepython2-certbot-apache @      certbotmod_sslpython(abi)python-augeaspython2-acmepython2-certbotrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PartialHardlinkSets)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)0.39.02.70.29.01.6.03.0.4-14.6.0-14.0.4-14.0-15.2-14.11.3_T_@_ǁ_~@_|\@_9_!d_c^ۅ@^^@^_@^[^;^6^5h@^2@]@]]?]w@]c]Z@]:@]1] \"\]o@\U@\N\[@[\[M@[H@[(@[!@[@Z@Z@ZZZZ_@Z}@ZtRZ:PYp@Yp@Y*@Y@Y)@YyYYXQ@XZXX@XWw@W@Wf@WaC@WV@WQq@WM|WF@WF@Felix Schwarz - 1.11.0-1Felix Schwarz - 1.10.1-1Felix Schwarz - 1.10.0-1Nick Bebout - 1.9.0-1Nick Bebout - 1.8.0-1Felix Schwarz - 1.7.0-1Fedora Release Engineering - 1.6.0-2Felix Schwarz - 1.6.0-1Felix Schwarz - 1.5.0-1Miro Hrončok - 1.4.0-2Felix Schwarz - 1.4.0-1Felix Schwarz - 1.3.0-1Felix Schwarz - 1.2.0-2Felix Schwarz - 1.2.0-1Felix Schwarz - 1.1.0-2Felix Schwarz - 1.1.0-1Fedora Release Engineering - 1.0.0-2Eli Young - 1.0.0-1Eli Young - 0.39.0-2Eli Young - 0.39.0-1Eli Young - 0.38.0-1Eli Young - 0.37.2-1Miro Hrončok - 0.36.0-3Fedora Release Engineering - 0.36.0-2Eli Young - 0.36.0-1Eli Young - 0.35.1-1Eli Young - 0.34.2-1Eli Young - 0.31.0-1Fedora Release Engineering - 0.30.2-2Eli Young - 0.30.2-1Eli Young - 0.29.1-1Eli Young - 0.28.0-1Eli Young - 0.27.1-1Eli Young - 0.26.1-1Fedora Release Engineering - 0.25.1-3Miro Hrončok - 0.25.1-2Eli Young - 0.25.1-1Eli Young - 0.25.0-1Eli Young - 0.24.0-2Eli Young - 0.24.0-1Eli Young - 0.23.0-1Eli Young - 0.22.2-1Eli Young - 0.22.0-1Iryna Shcherbina - 0.21.1-3Fedora Release Engineering System Environment/Baselinuxx86_64%3Bv3$:hp*]FA큤fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"fL"9de90d84f83a95bed1ad7670feaff8f842cf11e4b1350c0d1bc7d2f98bb2ee6faf90797821b24ffdd108a81174d653bcd2df956b50cc0e0e4edf70220123d12e188029a4a5fc320b6157195899bf6d424610d385949a857a811d992602fa48c917657f4ee63966a9c7687e97028b9ca514f6e9bcbefec4b7f4e81ac861eb34838b48b04b336bd725b9e611c441c65456a4168083c4febc28e88828d8ec14827f77e0e92b7c64862bfdaee6d40bb998aacbcaad0e54d0bbcf63ea34839083e20696a0d5aa99059b937b46828d611b0cce3d765b05d110b0b081365c61487b22ed66e684fe666f736395deec4e6813aa4e567074447984cf77b4b36c0bfa7f49d6015cd51cb0c440aa184f7be117fc40b6137eda73364f693306fc6cd88a854f2f0b0ac44db7a9798cd073fd3d60019242b7b1f3f35b33b1e1dc8b8c60f98744ac90ca35d17482fe28df0954c3a2ebb9727a1ebcd6a98a181039b807f6de8fd9c84444c0b7a0eb2a9fe9f1348e1bb43108485174bcc03ac28d913da475eefb38896bd405d978eb64a53fb6bcb0d9e1a261c6f72602e602f31949c57445384bfb8bf2623d9807f80c797cef3d34d95a5306d15136704426e7866dbcbe1334f14bca9a3c183efbb1a0a60bc3981ced2f7df7123802b44d68d2d9deac3cc1d43db8245d19c254501857abde689bba074f8dbc10ea6a31353dc36b913738180422bc28b544a71ad387e81f52ad268689aa6c090caac14762facfce4b3a66a467539cd996171c133b33b6db82fe59ca91d45a5dc2803bba19501f00e06d243514da1f76394924622dfba63003e3b0eb4bdf696c73c71e55c83c12d5a74e87a31c944779d976c55ac86732e96e80ea9a383395ca395a1a9fbfa3bfd2539ed6285be0de49ac3e811c49cac013f48b46a20a514b1dbc1a55831498dd4d211bf111a0faa3a9f2a3d051787549a0de918add71dc69edd55f7cafeac81ce71c159ea67650d64e94a2f38fd8b16ddc83d908380d590020811fadb6a0abef793270dd2635c51a286ffe7a75b253c4f79bc0879cac8dc72781a2aa586452246d56544479cb9393038177f97513213526df2cf6184d8ff986c675afb514d4e68a404010521b880643../usr/lib/os-releasecentos-releasecentos-releasecentos-releasecentos-releaserootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootcentos-release-7-9.2009.2.el7.centos.src.rpmcentos-releasecentos-release(upstream)centos-release(x86-64)config(centos-release)redhat-releasesx>XQVI$IIIerences - applet: startup speed enhancements - applet: better support for OTP/token-based WiFi connections (rh #526383) - applet: show GSM and CDMA registration status and signal strength when available - applet: fix zombie GSM and CDMA devices in the menu - applet: remove 4-character GSM PIN/PUK code limit - applet: fix insensitive WiFi Create... button (rh #541163) - applet: allow unlocking of mobile devices immediately when plugged in- core: update to final 0.8 release - core: fix Bluetooth DUN connections when secrets are needed - ifcfg-rh: add helper for initscripts to determine ifcfg connection UUIDs - applet: fix Bluetooth connection secrets requests - applet: fix rare conflict with other gnome-bluetooth plugins- core: fix mobile broadband PIN handling (rh #543088) (rh #560742) - core: better handling of /etc/hosts if hostname was already added by the user - applet: crash less on D-Bus property errors (rh #557007) - applet: fix crash entering wired 802.1x connection details (rh #556763)- core: validate the autostart .desktop file - build: fix nmcli for the stricter ld (fixes FTBFS) - build: fix nm-connection-editor for the stricter ld (fixes FTBFS) - applet: don't autostart in KDE on F13+ (#541353)- core: add Bluetooth Dial-Up Networking (DUN) support (rh #136663) - core: start DHCPv6 on receipt of RA 'otherconf'/'managed' bits - nmcli: allow enable/disable of WiFi and WWAN- ifcfg-rh: read and write DHCPv6 enabled connections (rh #429710) - nmcli: update- core: clean NSS up later to preserve errors from crypto_init()- core: support for managed-mode DHCPv6 (rh #429710) - ifcfg-rh: gracefully handle missing PREFIX/NETMASK - cli: initial preview of command-line client - applet: add --help to explain what the applet is (rh #494641)- build: fix for new pppd (rh #548520) - core: add WWAN enable/disable functionality - ifcfg-rh: IPv6 addressing and routes support (rh #523288) - ifcfg-rh: ensure connection is updated when route/key files change - applet: fix crash when active AP isn't found (rh #546901) - editor: fix crash when editing connections (rh #549579)- core: fix recognition of standalone 802.1x private keys - applet: clean notification text to ensure it passes libnotify validation- core: remove haldaemon from initscript dependencies (rh #542078) - core: handle PEM certificates without an ending newline (rh #507315) - core: fix rfkill reporting for ipw2x00 devices - core: increase PPPoE timeout to 30 seconds - core: fix re-activating system connections with secrets - core: fix crash when deleting automatically created wired connections - core: ensure that a VPN's DNS servers are used when sharing the VPN connection - ifcfg-rh: support routes files (rh #507307) - ifcfg-rh: warn when device will be managed due to missing HWADDR (rh #545003) - ifcfg-rh: interpret DEFROUTE as never-default (rh #528281) - ifcfg-rh: handle MODE=Auto correctly - rpm: fix rpmlint errors - applet: don't crash on various D-Bus and other errors (rh #545011) (rh #542617) - editor: fix various PolicyKit-related crashes (rh #462944) - applet+editor: notify user that private keys must be protected- nm: better pidfile handing (rh #517362) - nm: save WiFi and Networking enabled/disabled states across reboot - nm: fix crash with missing VPN secrets (rh #532084) - applet: fix system connection usage from the "Connect to hidden..." dialog - applet: show Bluetooth connections when no other devices are available (rh #532049) - applet: don't die when autoconfigured connections can't be made (rh #532680) - applet: allow system administrators to disable the "Create new wireless network..." menu item - applet: fix missing username connecting to VPNs the second time - applet: really fix animation stuttering - editor: fix IP config widget tooltips - editor: allow unlisted countries in the mobile broadband wizard (rh #530981) - ifcfg-rh: ignore .rpmnew files (rh #509621)- nm: fix PPPoE connection authentication (rh #532862)- install: better fix for (rh #526519) - install: don't build Bluetooth bits on s390 (rh #529854) -x.XRW`[$K[\Zd1056284da29b0faff1833d54da7b069d324787dac578ccdb9f3a90238329bb9c4cc3d9015ed9183f6878c955ef327400dc9dde355ea3b2bc43cb2ea1e030e67d5c6a947d6c8916e1e33b59d6e280069358eee0e73f5d0827953b67331d5b532544740aaba23f3475f8bd56a55b5a8edbe09839d838f0b66f4f60ac40cb5fd5587bd70694fe8f87ea2a9fd62f9dc83bdee351b10e267188994e6b1d1658cc9b1d7c906331b7e8bd421ba036e74d0bc25c6954aea1da945dc9080780f0a70f4ceaf54767acf2fbd62df989740a1e06885889b4ae2bfdd67633beb84168e9630748e05ff506e98b663054940c12cced88ece2daf6a35372acb1bba268ecad96cf79f3a6981d6473f697cf75d1f6e99a9564c7890ff341f3cdfb87721b4275bd7ccd5522f2fa700f234b1af8b0dc990c7e22c4dfab8578a9f848421307342b33f472adc8ffee48dffcb94787fc13ab073f003743de68e8d5b827c97ba3c0aaa96dd8ad4d9a9831cfa11caff572135a6ecc655ac34025dd8b6673e5260c7954055ab2f42e74d840fa39ce7155242f0dcb4007c536e0c3170421fb6b141d4da466da38bc2370be11c58316a7cd2d1ad6b81ff4435268c30ebb5ce03d63410dd691588fe08272f2865941282fa73089107d123c669b609cb04355f06e0d15d7df9f6f2dbdf0ae51d2cfea37af446ff8669cbb2bfb4e988c4983123f3caa6ef4e2711155bcb8e055216ecb64f419760de468e2397d24bc5b9e7fc1fb8000f76b3b17aaa92c8c4294344ea46d44c228edd8a78ba94129d4c48f142677f47826b7bf61ad48078661b53c5e57b48ecb03e40383408f58eeed2f32ecb0d67d8533552f91da8bf6e4589d62d44560fdaf9d0871f66d100f378e9e139287680d349d29bc2b4f5bd70b33e77601f2c1529484e200a9fdeb46fdd6aad15d257453c94638808b0df52c8ae4aca99cd8f85839c678c623ae97f264cf98b60bd293df206ada0fcd5bcc84e1805cfb8bd400567fde871aea133a8144e8126702d0baf77748b80f1958d3ba3ba36d82e5054c67b8f3328f418bdb11682781ede0817f758fce76dc2f2f6ffe1488724340be6468d0405df6d8eee2df7f2d291ca43f5bb652cd7e016e8dfc400ca5872abb332626622008b5ff85d4f2ee8ac682e6de73f7b0392d34dffdc15028ce7a19ded093e54720fb25405685f8d5415d418b6889acd58e82070dc92c166ef9405eebc1d44a45b784532eb99733b489773ce95d0ac2d80824900416c6a4c2b2966d3b747668622bb411fd47de4c763a981faa6b05082f7a71443ad3d6f5a820cc805b372a49d9c013447e7e93c8e8662c2363bae9553bafd1c8fc65b278074a995ebb067ff852e8262279c05a3bcf9d3c8b7271c43bc35a61664f5c3eeb5d28ddc314b39c236668c1ab69bf04471e1ea9179b92f7c52f3aee2d77ed164f9312b1abfb61006cc6a1c548b2c12afc781b28d1ac50f93d92d4313458004002ad2acb6e84a6b7f61a2a77bb4a5259468e1157b3b2a815f53f1222775fd02a512c493a7a36992bdcb2f8771b097ce4ab7943b0b7355b90c4e670e827d9a5d1e0616db71fd80befbff3d559c87cc265c04466f0be32199962c2e96685f6dd203010946b7566981f1e94c98cbad9443b71fed62e13176e1878b5bed6405f2d0421e34b4972b50eea3c119b5f599ab0da35c8c0507b540376474d9674af120bbfe5068a75085f0b7c287fff9964d65e6e230f6c99dd4a80191565ce4dcdd8fb87e96019677f53caad9f9621c7f6769eb257068061449f35cf77c70f8e7dcbd01aec4ef8a9efbafaeeb65cacb58e41268edcfc8e9986520f4fbc1f6b275ce061265134ca951102a30b9776a2585bb9fa15871b81381c452e5d940d167c3c51dbae4a1de09ca43721e32715cd4a41161abc04d42fd817f94e7269585701ec6840adcbf23a0afe37f2edfdb628b53378d56da4cbb9b1381986328afb44c7c5ecaed0ef572ef78f25557d5cf95fad1d0a9fe4fecdce39c98bc5137214fd7c0984ec2e0a4dfd5d7fb65e4e99bb934bab89b15819e0ddc7d67f8fc08cd3cb429a45eb92e0d36a72df412884abae6737781bef0782b9a7f4ef8b213353c6161ce9b63c5e7b08a2c4c518db9f2581cb5a6342e4a8b074e5aa48b0de4de83546dded440005b744317f0f345c74e6c5fc4dff1489f634b672faade665d2d77fb040a990a33120fbf66e4af2e0694618833acb261f1181649dba3593b996bddd320e160596c8414c863c2d9e966ce484686f5bdf77e2f00a30c61c03baa49656e86df6e6609421575ef8fcc644b62c3753b65896c51aeec4cdbaffed62c49d125cd15e4bc381e568a98681301c302e441844e06c60b2f04095f93247b40a9f10ca35bb0dcbf2ba46fa9c6d180330fc6c89c67ddf71ca0070c277623777074989492b29ba64b356c8398ead51d32165ea2affe14b743de14e60c231071b18156e6a5198da2a256ea8a940e463e57e13a623a73ca401c8c5b987baf45d4f7d3ea56322ebe95892a90ce098afad268f9e7f3cb9853e9b1c3499f543cb7b91e60d5b8af159405f3b593acbab6e1022dfaf258b3d9658dffefefdc11aa42e765a00496aa545d17c6d9c2e432e06c5a59f36cf4a42e8af4566882b2582f80f98c5361310b0b0c31166de1b2df35c711a5fe421fdac41b1a30da6526ca9d61b509113b731b71da2759adfa0c8cafce948d3fedf4723bdd9ac47220e99430325f9508ce4a065e499ccbf53a3308469dd122321bdf5d7d144a1558d01da80c3f5f2628349d52ff8989bc1fe410f2cdfedbcc4246db9efc07610e854xXS:X%$tool" causing the build to fail. (Change was done on Nov 11, but left uncommented.)- Extend the file existence check for "init.d/mysql" on un-install to also guard the call to "insserv"/"chkconfig".- added more man pages- Made yaSSL support an option (off by default)- Enabled yaSSL support- Give mode arguments the same way in all places lenz@mysql.com> - fixed the removing of the RPM_BUILD_ROOT in the %clean section (the $RBR variable did not get expanded, thus leaving old build roots behind)- Fixed the creation of the mysql user group account in the postinstall section (BUG 12348) - Fixed enabling the Archive storage engine in the Max binary- Fixed the Requires: tag for the server RPM (BUG 12233)- create a "mysql" user group and assign the mysql user account to that group in the server postinstall section. (BUG 10984)- Do not build statically on i386 by default, only when adding either "--with static" or "--define '_with_static 1'" to the RPM build options. Static linking really only makes sense when linking against the specially patched glibc 2.2.5.- added mysql_client_test to the "bench" subpackage (BUG 10676) - added the libndbclient static and shared libraries (BUG 10676)- use "mysqldatadir" variable instead of hard-coding the path multiple times - use the "mysqld_user" variable on all occasions a user name is referenced - removed (incomplete) Brazilian translations - removed redundant release tags from the subpackage descriptions- Added a "make clean" between separate calls to "BuildMySQL".- Removed the mysql_tableinfo script made obsolete by the information schema- Enabled the "blackhole" storage engine for the Max RPM- removed the MySQL manual files (html/ps/texi) - they have been removed from the MySQL sources and are now available seperately.- old mysqlmanager, mysq* Mon Feb 7 2005 Tomas Ulin - enabled the "Ndbcluster" storage engine for the max binary - added extra make install in ndb subdir after Max build to get ndb binaries - added packages for ndbcluster storage engine- replaced obsoleted "BuildPrereq" with "BuildRequires" instead- enabled the "Federated" storage engine for the max binary- ISAM and merge storage engines were purged. As well as appropriate tools and manpages (isamchk and isamlog)- enabled the "Archive" storage engine for the max binary - enabled the "CSV" storage engine for the max binary - enabled the "Example" storage engine for the max binary- MySQL-Max now requires MySQL-server instead of MySQL (BUG 3860)- do not link statically on IA64/AMD64 as these systems do not have a patched glibc installed- Added libmygcc.a to the devel subpackage (required to link applications against the the embedded server libmysqld.a) (BUG 4921)- Added EXCEPTIONS-CLIENT to the "devel" package- disabled OpenSSL in the Max binaries again (the RPM packages were the only exception to this anyway) (BUG 1043)- fixed server postinstall (mysql_install_db was called with the wrong parameter)- added mysql_tzinfo_to_sql to the server subpackage - run "make clean" instead of "make distclean"- added ncurses-devel to the build prerequisites (BUG 3377)- when using gcc, _always_ use CXX=gcc - replaced Copyright with License field (Copyright is obsolete)- added myisam_ftdump to the Server package- link the mysql client against libreadline instead of libedit (BUG 2289)- marked /etc/logrotate.d/mysql as a config file (BUG 2156)- fixed file permissions (BUG 1672)- made testing for gcc3 a bit more robust- added missing file mysql_create_system_tables to the server subpackage- removed dependency on MySQL-client from the MySQL-devel subpackage as it is not really required. (BUG 1610)- Fixed BUG 1162 (removed macro names from the changelog) - Really fixed BUG 998 (disable the checking for installed but unpackaged files)- Fixed BUG 959 (libmysqld not being compiled properly) - Fixed BUG 998 (RPM build errors): added missing files to the distribution (mysql_fix_extensions, mysql_tableinfo, mysqldumpslow, mysql_fix_prx XT Xp$=?d & aAQ ]s     < h { (89 8:aG$H4IDXHYT\|]^bdDeIfLlNhl_  _ jghCphp73-php-bcmath7.3.3314.el7.remiA module for PHP applications for using the bcmath libraryThe php73-php-bcmath package contains a dynamic shared object that will add support for using the bcmath library to PHP.f_builder.remirepo.net3Remi's RPM repository #StandWithUkrainePHP and LGPLv2+Remi ColletDevelopment/Languageshttp://www.php.net/linuxx86_642`<gA큤f_f_f_f_@17da5c7d4e51e0d3841f59ef008905f916e46e953f20156863c7a0f882802aa6806276283306babb5d0c9c9b8ff40a06e911d96ad59751a72f21db9d0fdc23da794d42bb61efc31014df323e828af910c1473664885ce76b4bb9c4c4638718c5rootrootrootrootrootrootrootrootphp73-php-7.3.33-14.el7.remi.src.rpmbundled(libbcmath)php73-php-bcmathphp73-php-bcmath(x86-64)   @@@@@@ php73-php-common(x86-64)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)rtld(GNU_HASH)rpmlib(PayloadIsXz)7.3.33-14.el7.remi4.6.0-14.0-13.0.4-15.2-14.11.3f_f@e 0@dddq@cwcR@cV~@c2b=b!a@awapaI@a$@` @```n@`>`@_T_إ@___ ___s!_`_N7_;_)M__c^^^y^^^^^0^p^^F^K^9\^&^r]@]N@]@]µ]@]z@]@]x]w@]fl]Z@]@1@]-@]]]G@] u@]@]\\]@\"\@\ڭ\Ɋ@\Ɋ@\\C@\@\N\|\\~d\o@\k\j@\\\Yz\G\@n@\?\4\@\l@[@[@[0[ @[@[#@[@["@[9@[9@[ug@[M@[;e@[+@[(@[@[[WZz@Z(Z@ZZlZ2@Z`@Z@Z$U2G@U/@UU@U@U@U@U @T9T@TTC@TTp@T5Tw@TuThTd@TVT?@T.Tk@SSSr @S,)S?SR@R@R@RRRRR_@R:@RQ@QY@QY@QQQ@Q@QQyQfQ@j@P@PѬ@PP@P@P*P@P@P)P)PPPPPP5@P{Px@Pl(Pj@PiPiPe@P`K@PYPYPYPXb@PWPS@P2&P.2@P H@O@O@O O@O\@Os@O@O@OvOtNOpZ@OpZ@OP@O?O-OO@O @NNN@N@N @NoENS@NLN7@MMMMTMtMk@MfH@MRM'@M@M@MgL8LΫLʷ@LLH2K@K@KCK@K @KK@J@JlE@J_@J_@J\s@JY@J> I'@I@II@I@I}I|T@Iy@ICI>]I:i@I9I*@I9@H˫@H(H{?Hv@GGZ@Gt@GVGVGV@FFڥF@FS@FS@F]FFw@FiDFAF@f@F; @F @F@Eّ@EK@EE3@Eu_@El$El$Ej@E[@E[@EG:E#@D,@D@DbDbD(@DtJDlaD_2DX@D;@C@CCQ@CˊCǖ@C @CCf@CqC @C@C7@C@Cs6@CoACgXC(BiB{\@BwgBlB] B] B] B[@BZfBQ,@BM7BJBBBB @A@AxpXU[`pi$]iii0490170c6bcf13612c4c6c20c0959906b0b15baa5bdb18dfdd4d50d1e5070fec1ba1cbf359b6ec882f44fca2df6df21f8337268b1af1998606a621e616524ae14e7e5d11200ed5d9d432f9399cf99622cad4dcd427c159ec9039065d0b524ae14e7e5d11200ed5d9d432f9399cf99622cad4dcd427c159ec9039065d0b475d7e3c4bdb719d361a64e576ff385b2b27e9e6dc8d21ae53eb67c1bbec831f261734ed0faa48b6f70d591917ded09f75f2478ce4dcf0d6efb33b53e88bbdbc261734ed0faa48b6f70d591917ded09f75f2478ce4dcf0d6efb33b53e88bbdbc0b89e94f96cfe0dac81592be8868b9ab2086cee3f8f449459d2761d844d76799f363caaa0a7da3cd7b2b417ed6f447d57db14272f294d22c1782357afa2c8f2ff363caaa0a7da3cd7b2b417ed6f447d57db14272f294d22c1782357afa2c8f2fdc4c6e64854fbfb4d4525d4597f43b39063b082387060e9d2c75d09992ac80d2fd16991605b9cd44edf68205a8de5ebe41e9788c9422772ade7ba51503ab2fc87b943bce1a5d7689d85272ddad07bba489640bf9785c33d6a4707e935145a037bcd2ab9ba16c05d63629f8790ab2b5154350ddf7abcb66808e29cbf1a6b073cca8ff223fbdb7201b97f8adc1a8d647ebbde27cb3f8c94b966af00fb713462c20a8ff223fbdb7201b97f8adc1a8d647ebbde27cb3f8c94b966af00fb713462c208bc1444ced9704f7623bae9f59f871d8af6ebf9ee8098b54339d4b580d75cb27b954b07c8b5a31bcbcbe28f334e0c223091b11f76f24dbfddf88e8d5ddeb1ce7b954b07c8b5a31bcbcbe28f334e0c223091b11f76f24dbfddf88e8d5ddeb1ce7506ecae4a071936c8d1b8d1549383759f327fd73443e9a7994b44489a8a8d9d3386f8331bc74ea02a6395d2f154c48bc1544c51b732c9a4943a3cc8ee5acd21e386f8331bc74ea02a6395d2f154c48bc1544c51b732c9a4943a3cc8ee5acd21eed9224fd47858af9c82eef966ac6edfa2529dbc2a2db3f973efadeede4bc406fab668b87ee57fca6c87c28e526d9b4ae63d300756c3ea581da0b8ca25d5f1695ab668b87ee57fca6c87c28e526d9b4ae63d300756c3ea581da0b8ca25d5f1695cd1620a346535da6110e72dd7450eb6c1023a2e915901108e704202fcd12d8a5294d8eaf41183d3c28f8d0c21bbfb70c22fe4f5e96387188ebf0bbcca63e9c69294d8eaf41183d3c28f8d0c21bbfb70c22fe4f5e96387188ebf0bbcca63e9c698121af443f316306478f96976edd25da446e930a75524e95de0179ac437d3112d031d4f50b20178eefa85616f501401261be1955ca4233777497ae7d7946cb98d031d4f50b20178eefa85616f501401261be1955ca4233777497ae7d7946cb984d8df47e8f4a4715d15dda4cef01d07aa338ee85f5029cb6e09a86d21f4f182f967ad7b0ebaf0dceae09be030ec6d76942d14d42679bfb370011115de9b09f81967ad7b0ebaf0dceae09be030ec6d76942d14d42679bfb370011115de9b09f81c4188cab5e8ff756526a6f3bb236ae97da495cecb200b72a30a0db27614436185f7b153fc47b9ff30a73653503ed09837dd30693436c3f98f126a6b490a44a0f5f7b153fc47b9ff30a73653503ed09837dd30693436c3f98f126a6b490a44a0f879246a925062a15b68f3facc3cd242e10dd253b13d4939fbc5c60e2d40cf1c1493b3ca902e965a956553eeca9a87b2bcaa08bf3bf8945ef4c003db882f7247c493b3ca902e965a956553eeca9a87b2bcaa08bf3bf8945ef4c003db882f7247c9289af02976b8e27ce7aa64b6dc8cfe97a3d21fd72aa50d22f74c5a9a2cb9a386c484e4e6ad3679f53e56321087a6e48746403c0e2b9cf6c3b20df1fdf408ce66c484e4e6ad3679f53e56321087a6e48746403c0e2b9cf6c3b20df1fdf408ce6853fde68fcbe6c11a6b9ac6e88ca13feef84e4dcdcf497e8fd6ecc0b08f49cbb72f47f24ce9d18b590cddb4b40e8476a03624fefc98c6a73fc4befcd44ed196c72f47f24ce9d18b590cddb4b40e8476a03624fefc98c6a73fc4befcd44ed196c28619b3269796b1843d7d8bcf5640f068812cf60ee6198352d655ea06442de144152fef12607e783d6bb1feeaa8478ee503ebb9fb63bc52de6aef4138b66402a4152fef12607e783d6bb1feeaa8478ee503ebb9fb63bc52de6aef4138b66402a726e51a3f46a8825fb28123376c150546baa3018e3017b3c9ccd1838487b6607f91f4dcdab8911a6e78533c5b173895d9c61aca847609d87f821b8b2c792e127f91f4dcdab8911a6e78533c5b173895d9c61aca847609d87f821b8b2c792e12734783b9e2210f5c4a23bced2dfd7ec289834716673354ed7c7abf69fe30192a35cc003edd93fb9cd03d40c7686495f8f058f485f75b5e764b789245a386e6daff4ea15f697ed51ae6bf72b89acb1b1105aa2445632dd4e3ae0a479dc89e5451e2cc5de715ae5a976f086fba4930880c9e421914173fc85111bff514d4757123fxXVX5 $  j t for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- 0.18 bump- Fix a typo, sort the deps- 0.17 bump- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Perl 5.16 rebuild- 0.16 (IO::Socket::INET compatibility enhancement)- 0.15 bump- 0.14 bump- Perl 5.16 rebuild- 0.11 bump- 0.10 bump- 0.09 bump- Specfile autogenerated by cpanspec 1.78. 0.210.21-5.el7perl-IO-Socket-IP-0.21ChangesLICENSEREADMEexamplesconnect.plnonblocking_libasyncns.plIO::Socket::IP.3pm.gzIOSocketIP.pm/usr/share/doc//usr/share/doc/perl-IO-Socket-IP-0.21//usr/share/doc/perl-IO-Socket-IP-0.21/examples//usr/share/man/man3//usr/share/perl5/vendor_perl//usr/share/perl5/vendor_perl/IO//usr/share/perl5/vendor_perl/IO/Socket/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnudirectoryASCII textPerl script, ASCII text executabletroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)Perl5 module source text PRRRRRRRRR R ?̉Zh.$ƨlQG(;  OU2navCRT/`Ef-. 79l]ك@ jLF\a,w󻝲]: Z@wo'F򞍞y;IM6U3 LXb4JHʽL~XuK#O]"7Yv\\zVVM}8g/ȑm{B8e2t, C9ɒ op)j츎2}GUO)Гak6$&2o5K/ W "!ܬ*)Յݪ0%Rag۾eRӫZ`j0fT}YEqpxT(=|[h[[$~+OL ˒TuvlXQ 8MՑf.Ut$qg.M)/mL/5&P~ }^`ը ^|` )Ǥw83OkgD@d-e&Hd+ZZh.$ƨ7^Dtth8%1橾}H2-R&2zeq#nr 7Uuekx[CTxv`bhPq*2q\zFjBYN"ACbsv/|vG)WJ>VooTe ͻ^k Rg,T%}q3<% ^'2dOAVݣGd1m 7#0YST˛;+r??Ǥ6,~\1`n4 {2>;hDe(H̥0ӺmW gEDr۱DR1FbEZ853d8e884ae6f1927b8192d6c54407e2a40a7718bL[bLibrary for kprobes and uprobes (Hendrik Brueckner) [879647] - [s390] ptrace: add struct psw and accessor function (Hendrik Brueckner) [879647] - [s390] kprobes: allow kprobes only on known instructions (Hendrik Brueckner) [879647] - [s390] dis: move disassembler function prototypes to proper header file (Hendrik Brueckner) [879647] - [s390] kprobes: use insn_length helper function (Hendrik Brueckner) [879647] - [s390] dis: move common definitions to a header file (Hendrik Brueckner) [879647] - [s390] dis: rename structures for unique types (Hendrik Brueckner) [879647] - [s390] mm: limit STACK_RND_MASK for compat tasks (Hendrik Brueckner) [1204860] - [s390] mm: align 64-bit PIE binaries to 4GB (Hendrik Brueckner) [1204860] - [s390] avoid z13 cache aliasing (Hendrik Brueckner) [1204860] - [s390] add z13 code generation support (Hendrik Brueckner) [1204860] - [s390] kernel: use stnsm 255 instead of stosm 0 (Hendrik Brueckner) [1204860] - [s390] time: use stck clock fast for do_account_vtime (Hendrik Brueckner) [1204860] - [s390] spinlock: optimize spin_unlock code (Hendrik Brueckner) [1204860] - [s390] spinlock: refactor arch_spin_lock_wait[_flags] (Hendrik Brueckner) [1204860] - [s390] rwlock: add missing local_irq_restore calls (Hendrik Brueckner) [1204860] - [s390] spinlock, rwlock: always to a load-and-test first (Hendrik Brueckner) [1204860] - [s390] spinlock: optimize spinlock cx`XW]Wc~$n~}ollet 5.4.0-0.3.RC7Remi Collet 5.4.0-0.2.RC6Remi Collet 5.4.0-0.1.RC6Remi Collet 5.3.8-4.4Remi Collet 5.3.8-4.3Adam Jackson - 5.3.8-4.2Marcela Mašláňová - 5.3.8-3.2Peter Schiffer - 5.3.8-3.1Remi Collet 5.3.8-3Remi Collet 5.3.8-2Remi Collet 5.3.8-1Remi Collet 5.3.7-1Joe Orton - 5.3.6-4Remi Collet 5.3.6-3Remi Collet 5.3.6-2Remi Collet 5.3.6-1Joe Orton - 5.3.5-6Caolán McNamara 5.3.5-5Remi Collet 5.3.5-4Remi Collet 5.3.5-3Fedora Release Engineering - 5.3.5-2Remi Collet 5.3.5-1Remi Collet 5.3.4-2Remi Collet 5.3.4-1.1Remi Collet 5.3.4-1Remi Collet 5.3.3-5Joe Orton - 5.3.3-4Joe Orton - 5.3.3-3Remi Collet 5.3.3-2Remi Collet 5.3.3-1Remi Collet 5.3.2-3Caolán McNamara 5.3.2-2Remi Collet 5.3.2-1Joe Orton - 5.3.1-3Joe Orton - 5.3.1-2Remi Collet 5.3.1-1Tom "spot" Callaway - 5.3.0-7Tomas Mraz - 5.3.0-6Fedora Release Engineering - 5.3.0-5Joe Orton 5.3.0-4Joe Orton 5.3.0-3Joe Orton 5.3.0-2Remi Collet 5.3.0-1Remi Collet 5.2.10-1Remi Collet - 5.2.9-1Fedora Release Engineering - 5.2.8-10Joe Orton 5.2.8-9Joe Orton 5.2.8-8Joe Orton 5.2.8-7Joe Orton 5.2.8-5Joe Orton 5.2.8-4Joe Orton 5.2.8-3Remi Collet 5.2.8-2Remi Collet 5.2.8-1Remi Collet 5.2.7-1.1Remi Collet 5.2.7-1Joe Orton 5.2.6-7Joe Orton 5.2.6-6Remi Collet 5.2.6-5Remi Collet 5.2.6-4Joe Orton 5.2.6-3Joe Orton 5.2.5-7Fedora Release Engineering - 5.2.5-6Joe Orton 5.2.5-5Joe Orton 5.2.5-4Release Engineering - 5.2.5-3Joe Orton 5.2.5-2Joe Orton 5.2.4-3Joe Orton 5.2.4-2Joe Orton 5.2.3-9Joe Orton 5.2.3-8Hans de Goede 5.2.3-7Joe Orton 5.2.3-6Joe Orton 5.2.3-5Joe Orton 5.2.3-4Joe Orton 5.2.3-3Joe Orton 5.2.3-2Joe Orton 5.2.2-4Joe Orton 5.2.2-3Joe Orton 5.2.2-2Joe Orton 5.2.1-5Joe Orton 5.2.1-4Joe Orton 5.2.1-3Joe Orton 5.2.1-2Joe Orton 5.2.0-10Joe Orton 5.2.0-9Joe Orton 5.2.0-8Joe Orton 5.2.0-7Joe Orton 5.2.0-6Joe Orton 5.2.0-5Joe Orton 5.2.0-4Joe Orton 5.2.0-3Joseph Orton 5.1xXXW(o($cing php- rebuild for new libpq soname- bundle from PEAR: HTTP, Mail, XML_Parser, Net_Socket, Net_SMTP - snmp: disable MSHUTDOWN function to prevent error_log noise (#153988) - mysqli: add fix for crash on x86_64 (Georg Richter, upstream #32282)- build shared objects as PIC (#154195)- fix PEAR installation and bundle PEAR DB-1.7.5 package- update to 5.0.4 (#153068) - add .phps AddType to php.conf (#152973) - better gcc4 fix for libxmlrpc- BuildRequire mysql-devel >= 4.1 - don't mark php.ini as noreplace to make upgrades work (#152171) - fix subpackage descriptions (#152628) - fix memset(,,0) in Zend (thanks to Dave Jones) - fix various compiler warnings in Zend- package mysqli extension in php-mysql - really enable pcntl (#142903) - don't build with --enable-safe-mode (#148969) - use "Instant Client" libraries for oci8 module (Kai Bolay, #149873)- fix build with GCC 4- install the ext/gd headers (#145891) - enable pcntl extension in /usr/bin/php (#142903) - add libmbfl array arithmetic fix (dcb314@hotmail.com, #143795) - add BuildRequire for recent pcre-devel (#147448)- update to 5.0.3 (thanks to Robert Scheck et al, #143101) - enable xsl extension (#142174) - package both the xsl and dom extensions in php-xml - enable soap extension, shared (php-soap package) (#142901) - add patches from upstream 5.0 branch: * Zend_strtod.c compile fixes * correct php_sprintf return value usage- update for db4-4.3 (Robert Scheck, #140167) - build against mysql-devel - run tests in %check- truncate changelog at 4.3.1-1 - merge from 4.3.x package: - enable mime_magic extension and Require: file (#130276)- fix dom/sqlite enable/without confusion- fix phpize installation for lib64 platforms - add fix for segfault in variable parsing introduced in 5.0.2- update to 5.0.2 (#127980) - build against mysqlclient10-devel - use new RTLD_DEEPBIND to load extension modules - drop explicit requirement for elfutils-devel - use AddHandler in default conf.d/php.conf (#135664) - "fix" round() fudging for recent gcc on x86 - disable sqlite pending audit of warnings and subpackage split- don't build dom extension into 2.0 SAPI- ExclusiveArch: x86 ppc x86_64 for the moment- fix default extension_dir and conf.d/php.conf- update to 5.0.1 - only build shared modules once - put dom extension in php-dom subpackage again - move extension modules into %{_libdir}/php/modules - don't use --with-regex=system, it's ignored for the apache* SAPIs- Merge in some spec file changes from Jeff Stern (jastern@uci.edu)- bump to 5.0.0 - add patch to prevent clobbering struct re_registers from regex.h - remove domxml references, replaced with dom now built-in - fix php.ini to refer to php5 not php4/bin/sh/bin/sh/bin/sh/bin/sh/bin/sh 5.6.40-41.el7.remi5.6.40-41.el7.remi php56-php-fpmphp56-php-fpm.service.dphp-fpm.confphp-fpm.dwww.confphp-fpmphp-fpmphp56-php-fpm-5.6.40php-fpm.conf.defaultfpmstatus.htmlphp56-php-fpm-5.6.40fpm_LICENSEphp-fpm.8.gzsessionwsdlcachephp-fpmphp-fpmphp56-php-fpm.service/etc/logrotate.d//etc/systemd/system//opt/remi/php56/root/etc//opt/remi/php56/root/etc/php-fpm.d//opt/remi/php56/root/etc/sysconfig//opt/remi/php56/root/usr/sbin//opt/remi/php56/root/usr/share/doc//opt/remi/php56/root/usr/share/doc/php56-php-fpm-5.6.40//opt/remi/php56/root/usr/share//opt/remi/php56/root/usr/share/fpm//opt/remi/php56/root/usr/share/licenses//opt/remi/php56/root/usr/share/licenses/php56-php-fpm-5.6.40//opt/remi/php56/root/usr/share/man/man8//opt/remi/php56/root/var/lib/php//opt/remi/php56/root/var/log//opt/remi/php56/root/var/run//usr/lib/systemd/system/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -m64 -mxPXYWhaQ$AQRP     !!"!!!!!!!!""!!!!!!!!!!!"!!!!!!!!!"#$%POSIX shell script, ASCII text executabledirectoryC source, ASCII textHTML document, ASCII textASCII textC source, UTF-8 Unicode textHTML document, UTF-8 Unicode textpkgconfig fileUTF-8 Unicode textPNG image data, 394 x 313, 4-bit colormap, non-interlacedPNG image data, 390 x 429, 4-bit colormap, non-interlacedPNG image data, 411 x 405, 2-bit colormap, non-interlacedPNG image data, 453 x 378, 2-bit colormap, non-interlacedPNG image data, 228 x 264, 2-bit colormap, non-interlacedPNG image data, 217 x 229, 2-bit colormap, non-interlacedPNG image data, 580 x 40, 4-bit colormap, non-interlacedPNG image data, 107 x 37, 4-bit colormap, non-interlacedPNG image data, 116 x 37, 4-bit colormap, non-interlacedPNG image data, 539 x 151, 4-bit colormap, non-interlacedPNG image data, 273 x 263, 2-bit colormap, non-interlacedPNG image data, 402 x 390, 1-bit grayscale, non-interlacedPNG image data, 458 x 179, 1-bit colormap, non-interlacedPNG image data, 162 x 275, 1-bit colormap, non-interlacedPNG image data, 388 x 253, 1-bit colormap, non-interlacedPNG image data, 294 x 278, 1-bit colormap, non-interlacedPNG image data, 236 x 183, 1-bit grayscale, non-interlacedPNG image data, 225 x 204, 1-bit grayscale, non-interlacedPNG image data, 214 x 162, 1-bit grayscale, non-interlacedPNG image data, 221 x 166, 1-bit grayscale, non-interlacedPNG image data, 314 x 38, 4-bit colormap, non-interlacedPNG image data, 115 x 36, 4-bit colormap, non-interlacedPNG image data, 275 x 261, 2-bit colormap, non-interlacedHTML document, ASCII text, with very long linesHTML document, UTF-8 Unicode text, with very long linesC++ source, UTF-8 Unicode textC++ source, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)xȩXZWh$geleases/5_6_5.php- fix php-fpm.service.d location- update to 5.6.5RC1 - add base system path in default include path - FPM: enable ACL for Unix Domain Socket- Update to 5.6.4 http://www.php.net/releases/5_6_4.php - add sybase_ct extension (in mssql sub-package) - xmlrpc requires xml- Update to 5.6.4 http://www.php.net/releases/5_6_4.php- update to 5.6.4RC1- add embedded sub package - filter all libraries to avoid provides- FPM: add upstream patch for https://bugs.php.net/68421 access.format=R doesn't log ipv6 address - FPM: add upstream patch for https://bugs.php.net/68420 listen=9000 listens to ipv6 localhost instead of all addresses - FPM: add upstream patch for https://bugs.php.net/68423 will no longer load all pools- Update to PHP 5.6.3 http://php.net/releases/5_6_3.php- update to 5.6.3RC1 - new version of systzdata patch, fix case sensitivity - ignore Factory in date tests - disable opcache.fast_shutdown in default config - add php56-cgi command in base system- Update to PHP 5.6.2 http://php.net/releases/5_6_2.php- Update to PHP 5.6.1 http://php.net/releases/5_6_1.php - use default system cipher list by Fedora policy http://fedoraproject.org/wiki/Changes/CryptoPolicy - add system php library to default include_path- enable libvpx on EL 6 (with libvpx 1.3.0) - add php56-phpdbg command in base system- PHP 5.6.0 is GA - add lsphp56 command in base system- initial spec for PHP 5.6 as Software Collection - adapted from php 5.6 spec file from remi repository - adapted from php 5.5 spec file from rhscl 1.1- fileinfo: fix out-of-bounds memory access CVE-2014-2270 - fileinfo: fix extensive backtracking CVE-2013-7345- gd: fix NULL deref in imagecrop CVE-2013-7327 - gd: drop vpx support, fix huge memory consumption #1075201- fix patch name - fix memory leak introduce in patch for CVE-2014-1943 - fix heap-based buffer over-read in DateInterval CVE-2013-6712- fix infinite recursion in fileinfo CVE-2014-1943- fix heap overflow vulnerability in imagecrop CVE-2013-7226- allow multiple paths in ini_scan_dir #1058161- add security fix for CVE-2013-6420- rebuild with test enabled - add dependency on php-pecl-jsonc- update to PHP 5.5.6 - buildstrap build- update to PHP 5.5.5 - mod_php only for httpd24- update to PHP 5.5.4 - improve security, use specific soap.wsdl_cache_dir use /var/lib/php/wsdlcache for mod_php and php-fpm - sync short_tag comments in php.ini with upstream - relocate RPM macro- update to PHP 5.5.3 - improve system libzip patch - fix typo and add missing entries in php.ini- update to PHP 5.5.1 for php55 SCL- rebuild for new httpd-mmn value- remove ZTS conditional stuf for ligibility - add mod_php for apache 2.4 (from httpd24 collection)- improve mod_php, pgsql and ldap description - add missing man pages (phar, php-cgi) - add provides php(pdo-abi) for consistency with php(api) and php(zend-abi) - use %__isa_bits instead of %__isa in ABI suffix #985350- add security fix for CVE-2013-4113 - add missing ASL 1.0 license- run tests during build- rebase to 5.4.16 - fix hang in FindTishriMolad(), #965144 - patch for upstream Bug #64915 error_log ignored when daemonize=0 - patch for upstream Bug #64949 Buffer overflow in _pdo_pgsql_error, #969103 - patch for upstream bug #64960 Segfault in gc_zval_possible_root- remove wrappers in /usr/bin (#966407)- rebuild for libjpeg (instead of libjpeg_turbo) - fix unowned dir %{_datadir}/fpm and %{_libdir}/httpd (#956221)- update to 5.4.14 - clean old deprecated options- update to 5.4.13 - security fixes for CVE-2013-1635 and CVE-2013-1643 - make php-mysql package optional (and disabled) - make ZTS build optional (and disabled) - always try to load mod_php (apache warning is usefull) - Hardened build (links with -z now option) - Remove %config from /etc/rpm/macros.php- update to 5.4.11 - fix php.conf to allow MultiViews managed by php scripts- update to 5.4.10 - remove patches merged upstream - drop "Configure Command" from phpinfo output - prevent php_config.h changes across (otherwise identical) rebuix@X[U 0:<$ <<<556bb5a881df4a2bebc461d6f77c32f580e15033a42d3c466bc3773cfe99672d29c521f2207d4fd703f7dd0e8fd04a8544e90dd0f4932e68e2abbd82ed748bad2e884e6ae621fe035068b6817c1c08323cfc13a1644251bcc90a7f7556b6c64a988e7d0d739b6d61fdb44b58f862032c70cd3222f0f9490164413e63977b301a23ffb0dc0c74231b116f7f723eb0d13a9d249b87e063d3ac494bb146b157f3c13f2bd3d9c4977aadd3d81ee81a888e7df4faf82055a352f08e71304591687158a9efd1b7339256d6f82e3132c8812db306f673564c5a47fa92433e5e9981e0b1b6c2c91cedb306feae85e8102780026b7969ccfac2f57c04a89562d5211b42e2d8e2967b99aa376d017802a1265b152ce7fd29b22528b1f48f8e9b4ea29e12a154ca0f8edee9217f67825320539ac84912c4cecc5aadc81783b542b05adcfdce5dfae0c750e4d7d787eeedb7401fa80b600b0e633d440c796371fd47fb67abb9d8f0d321f7df74c837285c7158357a01e06c5a027c175d3546f0af154e667fa6c71fb0d009e68366f4232ddeab23358a4b4354a3fea587738ff798539600ec9f97d5f0270152e183077409afd2c7dcf3d2456277627789bc3b257b6cc322ffbf76e5be35312c2ebfa8ecfcc6e6327b110b7f7e487bfe75abd2af1ef0509a513407fbd268820f88b3d63eca6b774b3aa3bea6ee3b4478324fef77c404fcbe07ab050a09c38f6b1ad44f38289a6c2ccbdafd291a47c70bd73991b811b1279483cf10d2f66f5d175bc344a3639847d1ba6ed006dc61d8a057a2aa9b54ae8f2afed706d6ef6c9ad49949de9330ce22125a9fabc56c0dc6c2314c979b6e400369b4e3b1f0287c753f891a27363f256ced4b7dcbc8478ff4937cdcaf477a49179731b45690d2b97acab3d6ecc333bb52cf478f46e155eb4d2775b2341c373bcd30d3b024dc932fc72944ad8f845c0e652f77ae3efdef636be4e3062776ec5cfe3395663e5f916fb0a6f3f757c417520910f048d7677a57ffc1a38cbc909ab12ca06daf4e1815d952db0ac970cf69ca815598078468e3a2ef3751560dd05c9fca62a269e2cf45cd87bbb663323c381a84773333ae0d3c4c269be8c29e1450519f3727b9e779a3bbb3a38c4040cfffc5ff32b3c92d173e7cb7f3a035d6b36a9e1a07fd4adb1282105fe77d98ab5fbb392830a74606b1fbdc319945fc2eb6b4566753c0dc9d79c255df40302195149b0b49d15b2bb5bc445fe082269292234aaded0e7ca4f93f0a1fb1c0677716b1e686df759163bc37a05c6d39fec40cb71d40d605cbfd900cdd627c79a2f8c3c17126079ef7e1f8799a73d5c940fab066dcd8681b95767fe888a20e9c7419d49d9e37f4e6094c1ece7d3605ef00e53393709078171902b8a784bb6498aba3fe0fe853f086d1d16c2be0bc77363dae97bf0e80204575044aea5c98a591b966688d498fbbeac3c6a5f623d48968abaffbc01397d92d1a5a7a5fa07c2d741bc0b9a8f3ddf8b9399b860b48599571499dff8cb663fce074edb0addc61ea2c70af20e846d8921778b42a6ee688bdb4f2d0a5f2045c5f98195df043e9aa6f278ba7a8c448cc49e49c837e1b93a0d4063cbfbbc85eae4eac512beec209c4bdfc6b2d0b53d2e2fe664b3bd18e85bda2209eb7bf6c7652a65b843434a9a137d211f171bd204626d9978340275c1740e48e3280287b8a02f492b344e1f5b4385ea6f2d45b848xX\W!p$.hp-pdo arch specific requires- disable zip extension per "No Bundled Libraries" policy (#551513)- rebuild for icu 4.6- fix systemd-units requires- add tmpfiles.d configuration for php-fpm - add Arch specific requires/provides- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 5.3.5 http://www.php.net/ChangeLog-5.php#5.3.5 - clean duplicate configure options- rebuild against MySQL 5.5.8 - remove all RPM_SOURCE_DIR- security patch from upstream for #660517- update to 5.3.4 http://www.php.net/ChangeLog-5.php#5.3.4 - move phpize to php-cli (see #657812)- ghost /var/run/php-fpm (see #656660) - add filter_setup to not provides extensions as .so- use mysql_config in libdir directly to avoid biarch build failures- rebuild for new net-snmp- add php-fpm sub-package- PHP 5.3.3 released- garbage collector upstream patches (#580236)- rebuild for icu 4.4- PHP 5.3.2 Released! - remove mime_magic option (now provided by fileinfo, by emu) - add patch for http://bugs.php.net/50578 - remove patch for libedit (upstream) - add runselftest option to allow build without test suite- update to v7 of systzdata patch- fix build with autoconf 2.6x- update to 5.3.1 - remove openssl patch (merged upstream) - add provides for php-pecl-json - add prod/devel php.ini in doc- use libedit instead of readline to resolve licensing issues- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rediff systzdata patch- update to v6 of systzdata patch; various fixes- update to v5 of systzdata patch; parses zone.tab and extracts timezone->{country-code,long/lat,comment} mapping table- update to 5.3.0 - remove ncurses, dbase, mhash extensions - add enchant, sqlite3, intl, phar, fileinfo extensions - raise sqlite version to 3.6.0 (for sqlite3, build with --enable-load-extension) - sync with upstream "production" php.ini- update to 5.2.10 - add interbase sub-package- update to 5.2.9- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add recode support, -recode subpackage (#106755) - add -zts subpackage with ZTS-enabled build of httpd SAPI - adjust php.conf to use -zts SAPI build for worker MPM- fix patch fuzz, renumber patches- drop obsolete configure args - drop -odbc patch (#483690)- split out sysvshm, sysvsem, sysvmsg, posix into php-process- move wddx to php-xml, build curl shared in -common - remove BR for expat-devel, bogus configure option- rebuild for new MySQL- libtool 2 workaround for phpize (#476004) - add missing php_embed.h (#457777)- update to 5.2.8- libtool 2 workaround- update to 5.2.7 - enable pdo_dblib driver in php-mssql- tweak Summary, thanks to Richard Hughes- move gd_README to php-gd - update to r4 of systzdata patch; introduces a default timezone name of "System/Localtime", which uses /etc/localtime (#469532)- enable XPM support in php-gd - Fix BR for php-gd- enable T1lib support in php-gd- update to 5.2.6 - sync default php.ini with upstream - drop extension_dir from default php.ini, rely on hard-coded default, to make php-common multilib-safe (#455091) - update to r3 of systzdata patch- split pspell extension out into php-spell (#443857)- Autorebuild for GCC 4.3- ext/date: use system timezone database- rebuild for libc-client bump- Rebuild for openssl bump- update to 5.2.5- correct pcre BR version (#333021) - restore metaphone fix (#205714) - add READMEs to php-cli- update to 5.2.4- rebuild for fixed APR- add ldconfig post/postun for -embedded (Hans de Goede)- add php-embedded sub-package- fix build with new glibc - fix License- define php_extdir in macros.php- obsolete php-dbase- add mcrypt, mhash, tidy, mssql subpackages (Dmitry Butskoy) - enable dbase extension and package in -common- update to 5.2.3 (thanks to Jeff Sheltren)- fix php-pdo *_arg_force_ref global symbol abuse (#216125)- rebuild against uw-imap-devel- update to 5.2.2 - synch changes from upstream recommended php.ini- enable SASL support in LDAP extension (#205772)- drop mime_magic extension (dx xX]Ua$;aaaa45865ea62b1398c757147c6e738327707a917791ff52b27a16acd052505487c577f6906bc7a33967ac1d679fa6cf13aa783e93770f003f67981ea75f1d7698d3609a8094dcce7031b119b02ea2d8dbe7ca4cf3be10372f0fe92f975f1d7698d3609a8094dcce7031b119b02ea2d8dbe7ca4cf3be10372f0fe92f9955bdc85d8cafd1cd18fbe7d7a0e1132f1961df8016e3d2d2863a867c75b472688f26a21c71bd89f97e75bc94a8e478b77b28e375b95435bc766990ae48923eb88f26a21c71bd89f97e75bc94a8e478b77b28e375b95435bc766990ae48923eb5765e91cb28b0b142e9b737dc653b721471c003ec123291932a744716113def618daaecb339fff645d9d184a1ae610a691686802a33b01110a2e314e3ab475ce18daaecb339fff645d9d184a1ae610a691686802a33b01110a2e314e3ab475ce331d6ffd3724b38b9d1c2b4333cab6c67614890d35803ec4a4fc9e430b0fdfe4acc02b224f88243d96fb7989cab880c917966c34b26f507c78e1fb56043707faacc02b224f88243d96fb7989cab880c917966c34b26f507c78e1fb56043707fa86a101abb1835d989d77502c70a9d2ca34a831cba3f2b111a864e60fb5617834cdc28fe915df0cbaca823667b59424048523257dff8e5018381124b00ffe7161cdc28fe915df0cbaca823667b59424048523257dff8e5018381124b00ffe716116bafd6590a0fb5e39ca6cb4546a623c986f044a49b55a910583da2a1813d59e0ee7876d0d8edbacd96eb85dff0bbd2f3b7061a62efaf3235eb0fe2715989fc50ee7876d0d8edbacd96eb85dff0bbd2f3b7061a62efaf3235eb0fe2715989fc53cfac76b5fe80dbbb70ff06124673a3ef3206352a8c7262ad63a9e27011c32f18d4c9bcefd864957b29f743f5592aca5385c4913f063efb7cde6c82ad9308fcc8d4c9bcefd864957b29f743f5592aca5385c4913f063efb7cde6c82ad9308fccf184254824a18c0b01e6baf97e856f660a77233c1816f4e6199087841483b5a29561698a6e66722c0534fd83dee72d6ba45cf9b3e2034c40975c1c75efe90cb59561698a6e66722c0534fd83dee72d6ba45cf9b3e2034c40975c1c75efe90cb53d5c451d1941425f44952d1cb8614f714b63e777875fb6750e6820cc67e043a75f5d74f0329467b5429c3c1118341f27ed51b9fcbd47e8d8ad1332a6d41069305f5d74f0329467b5429c3c1118341f27ed51b9fcbd47e8d8ad1332a6d4106930afc8fdb24cdf13c642787ca1fce07e5ae70e9114c81cdef3a5133b97b577a92e6b15b222ff842210ef9d0ca6c6abc91f86cc5d6c89a117ef00a0579ec0f481016b15b222ff842210ef9d0ca6c6abc91f86cc5d6c89a117ef00a0579ec0f48101bb1bcb082845fb3c565a0ad8d5aff0c6df2ba768c82ddc0ee0fae79015ba5531f53fe582244af7e8e5cfdec3acd4aea38d1c58a4c82d13ef19550b8e05b6b452f53fe582244af7e8e5cfdec3acd4aea38d1c58a4c82d13ef19550b8e05b6b45236de6c520310de379522e92a4873af074508b25e98e6dfa6993ff5de6a599a2693dc6127467e4404b0a2409e10b2c34f5951ec1bb2942d00c2c81f05f402ad3c93dc6127467e4404b0a2409e10b2c34f5951ec1bb2942d00c2c81f05f402ad3cbfc64bbab0f11ce82cb9b626d6279f8e5a679c941cc7656e4541adf4508907d9d8cc1fea68feeabeb3a12a8d20107d355198f70ca7c8f5534066905a97e239e3d8cc1fea68feeabeb3a12a8d20107d355198f70ca7c8f5534066905a97e239e3a2a45231f15993133831792dde80f937a781c26989eab43d28f86f490293fe1369e9fe9811537609804ced76c80d2c0c82f10ea05b2d75394ec18af5a6a3f8a469e9fe9811537609804ced76c80d2c0c82f10ea05b2d75394ec18af5a6a3f8a41ce3115f82e88a6ef914c6d66b0777a04c2e18d251f8294c444105915a41b11bdcc86adfa8a9cc55b1a84e6502936b0d27b83471d110742d74101edbc2e9b2c7dcc86adfa8a9cc55b1a84e6502936b0d27b83471d110742d74101edbc2e9b2c7c81f45f9f0d0a73bb5bfc701a0a808acbd9271436a8e592a133b58ac654243ed747a23660a0a849a92a23582c4efb175f2350aa4939c026835c4e03fe434b3ba747a23660a0a849a92a23582c4efb175f2350aa4939c026835c4e03fe434b3baeb31a04d35dc111c81248434e3e5feb007bbf35b5580b547a771f39903f2e7681ca34a6a7594d04c8db9ad0ac8093e1b911287729d8f76a791c78b807b13a2a51ca34a6a7594d04c8db9ad0ac8093e1b911287729d8f76a791c78b807b13a2a58d5f6f0f1df0465d1bb2872553ca127bee52a8743762909b4ad9aab579ead69e0be56d844edd5c6b44928634703799f46f406e4678f3514b76e35506ac07894e0be56d844edd5c6b44928634703799f46f406e4678f3514b76e35506ac07894e929ae59a946dbc36d6e46ab8dc7d668b62a6349da4bb32d039b6b46b91300e45977626b3e150a7ca2c043f843661a7802f8d0d68bc41c528dfdd677641866003977626b3e150a7ca2c043f843661a7802f8d0d68bc41c528dfdd67764186600399d51bab5219a8e19a480efff11dfaec8ba40c2b0c7f35e2547ad3410a69ed9d3dfad3ecd9098835e4ea335bb90bec4aeeddef410968ce231563f308b59f0e1d3dfad3ecd9098835e4ea335bb90bec4aeeddef410968ce231563f308b59f0e1dd2a454ad92d13dd571b9e0012fd293cf311612c93ac4cd6b3a3c4ae8e1f15ed0f76d9dcc5c8623d7d500954391c032ec6cc9e0971179e5xgX^Wv$&Lbs), for GNU/Linux 2.6.32, BuildID[sha1]=e41eb599ce8db786be93acaed082371daa54f80a, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=296b85f8bad8a97bb7ebde993650fe0ca0104038, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=8e9ed8a499d892e6d09f1504202e572137d53153, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=fffceedd5ca1b22758fff924f941c8330f30b3c9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=7aa03cc5d8557a6d230df1c43f7c2011fdc9fd21, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=cb5e1441d45b585dbf1af2924625230e58c9c9a4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=aa2ba71220b9a54a05ea77b1fac4928b70540fbd, strippedASCII text (gzip compressed data, was "RELEASE_NOTES", from Unix, last modified: Fri Apr 19 15:01:58 2013, max compression)empty (gzip compressed data, from Unix, max compression)troff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)*>RfRRRRRRRRRR R'RRRR"R$RRRR%RR,RRRRRRRR R'RRRR"R$RRRR%RR,RRRRRRRR R'RRRR"R$RRRR%RR,RRRRRRRR R'RRRR"R$RRRR%RR,RRRRRRRR R'RRRR"R$RRRR%RR,R!R#RRRR&RRRRRRRR%RR R'RRRR"R$RRRR,RRRRRRRR R'RRRR"R$RRRR%RR,? }<^$ƨ|>/ d&xKV%q h)}/#B YѶ`yqfk iu.W.3@bN5{! OhxUO;j\5Xv1/WG{zh,N:*OmZQj@& hT ʈΒG ,% Kmp6eufEgP/ /Kۧ7ƝAN#Ԡ!" A/{m{8̃ {ckH+ OSV2T%{6svX[2b'_ DcQ'Ș\hWhp6Elղ q"Ҥ7MX!`FNRO}VW\cb V1"@׸; R IfR  OM6yD,}9̋H93t g®`,7Xlj ^LĊG G>z/]y@n݉^$ƨ C(C݊b8FQ~ )p]GHQ Ƿ _њ1k}^WmٔimiC'{6L0W"ta5jN!?@(udj?,#9,gvBuEFdZi&>gʫq3vBZʌe {wAd ex(Mf"􇓲%j.5e pjsZJp\ JRfFgXnە^ :8ף;á\`1 :iu)p?^>jVhocԱJ%rB:\=s^|DfE:e=fX64S2CgBb:{C/H|^c.nxhF0+͉?!3&WJ{> ϩuʢB3;|G\V[HmWZfB.gaQ6 8B P7a69a38699de1222a6a60ffa55c18b21d3c791d7b&bner.group_lock (Alex Williamson) [1499022] - [virt] vfio: New external user group/file match (Alex Williamson) [1499022] - [virt] kvm-vfio: Decouple only xWX_WT$DTUSemove FreeType 1, to move to extras - Install new demos ftbench, ftchkwd, ftgamma, and ftvalid - Enable modules gxvalid and otvalid- add buildrequires libICE-devel, libSM-devel- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- Remove references to obsolete /usr/X11R6 paths- Switch requires to modular X- BuildRequire gettext- fix 'without_bytecode_interpreter 0' build: freetype-2.1.10-enable-ft2-bci.patch- Update to 2.1.10 - Add necessary fixes- Fix freetype-config on 64 bit platforms.- BuildRequires xorg-x11-devel- Rebuild- Upgrade to 2.1.9 - Since we are just using automake for aclocal, use it unversioned, instead of specifying 1.4.- rebuilt- Add patch from freetype CVS to fix problem with eexec (#117743) - Add freetype-devel to buildrequires and -devel requires (Maxim Dzumanenko, #111108)- Added -fno-strict-aliasing to CFLAGS and CXXFLAGS to try to fix SEGV and SIGILL crashes in mkfontscale which have been traced into freetype and seem to be caused by aliasing issues in freetype macros (#118021)- rebuilt- rebuilt- Upgrade to 2.1.7- allow compiling without the demos as that requires XFree86 (this allows bootstrapping XFree86 on new archs)- Rebuilt- Bump for rebuild- Fix crash with non-format-0 hdmx tables (found by David Woodhouse)- Version 2.1.4 - Relibtoolize to get deplibs right for x86_64 - Use autoconf-2.5x for freetype-1.4 to fix libtool-1.5 compat problem (#91781) - Relativize absolute symlinks to fix the -debuginfo package (#83521, Mike Harris)- rebuilt- fix build with gcc 3.3- Add a memleak fix for the gzip backend from Federic Crozat- Run libtoolize/aclocal/autoconf so that libtool knows to generate shared libraries on ppc64. - Use _smp_mflags (for freetype 2.x only)- Switch to using %configure (should fix #82330)- rebuilt- Make FreeType robust against corrupt fonts with recursive composite glyphs (#74782, James Antill)- Add a patch to implement FT_LOAD_TARGET_LIGHT - Fix up freetype-1.4-libtool.patch- Update to freetype 2.1.3 - Removed ttmkfdir sources and patches, as they have been moved from the freetype packaging to XFree86 packaging, and now to the ttmkfdir package - Removed patches that are now included in 2.1.3: freetype-2.1.1-primaryhints.patch, freetype-2.1.2-slighthint.patch, freetype-2.1.2-bluefuzz.patch, freetype-2.1.2-stdw.patch, freetype-2.1.2-transform.patch, freetype-2.1.2-autohint.patch, freetype-2.1.2-leftright.patch - Conditionalized inclusion of freetype 1.4 library.- disable perl, it is not used at all- Instead of removing unpackaged file, include it in the package.- Attempted to fix lib64 issue in freetype-demos build with X11_LINKLIBS - Cleaned up various _foodir macros throughtout specfile - Removed with_ttmkfdir build option as it is way obsolete- remove unpackaged files from the buildroot- Fix a bug with PCF metrics- Backport autohinter improvements from CVS- Fix from CVS for transformations (#68964)- Add another bugfix for the postscript hinter- Add support for BlueFuzz private dict value, fixing rendering glitch for Luxi Mono.- Add an experimental FT_Set_Hint_Flags() call- Update to 2.1.2 - Add a patch fixing freetype PS hinter bug- Added ft rpm build time conditionalizations upon user requests- Version 2.1.1- Add a fix for PCF character maps- automated rebuild- Updated freetype to version 2.1.0 - Added libtool fix for freetype 1.4 (#64631)- use "libtool install" instead of "install" to install some binaries (#62005)- Updated to freetype 2.0.9- Added proper docs+demos source for 2.0.8.- Added compat patch so 2.x works more like 1.x - Rebuilt with new build toolchain- Updated to freetype 2.0.8, however docs and demos are stuck at 2.0.7 on the freetype website. Munged specfile to deal with the problem by using {oldversion} instead of version where appropriate. - bumping release so that we don't collide with another build of freetype, make sure to change the release requirement in the XFree86 package- MadxFX`W؂hn $~n o m aDumper)perl(DBI::Gofer::Serializer::Storable)perl(DBI::Gofer::Transport::Base)perl(DBI::Gofer::Transport::pipeone)perl(DBI::Profile)perl(DBI::ProfileData)perl(DBI::ProfileDumper)perl(DBI::ProxyServer)perl(DBI::SQL::Nano)perl(DBI::Util::_accessor)perl(Data::Dumper)perl(DynaLoader)perl(Errno)perl(Exporter)perl(Fcntl)perl(File::Basename)perl(File::Spec)perl(Getopt::Long)perl(IO::Dir)perl(IO::File)perl(IO::Select)perl(IPC::Open3)perl(Math::BigInt)perl(RPC::PlClient)perl(RPC::PlServer)perl(Scalar::Util)perl(Storable)perl(Symbol)perl(Tie::Hash)perl(UNIVERSAL)perl(base)perl(constant)perl(strict)perl(utf8)perl(vars)perl(warnings)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)0:5.0040:5.0080:5.008_0010.20000.20013.0.4-14.6.0-14.0-15.2-14.11.1RURkR@Q@Q@QZ@QPrP;a@P H@O@OOu@O@O@O~OKp@OKp@O'ONMTMQ0@M# L*@LA@LLLV@L @K@K@J_@JjJ/@I@HGPGG@G!FҼFGFg@EqjDD{D@C@CCECC@C@B] BQ,@BM7BK@@@Dw@@,@?@? `>>R @>5@=@=y@=Q =[@=@<@<<< - 1.627-4Daniel Mach - 1.627-3Petr Pisar - 1.627-2Petr Pisar - 1.627-1Petr Pisar - 1.626-1Petr Šabata - 1.625-1Fedora Release Engineering - 1.623-2Petr Šabata - 1.623-1Petr Pisar - 1.622-6Fedora Release Engineering - 1.622-5Petr Pisar - 1.622-4Marcela Mašláňová - 1.622-3Petr Pisar - 1.622-2Petr Pisar - 1.622-1Petr Šabata - 1.620-1Marcela Mašláňová - 1.618-3Petr Pisar - 1.618-2Petr Pisar - 1.618-1Petr Šabata - 1.617-1Fedora Release Engineering - 1.616-5Marcela Mašláňová - 1.616-4Ville Skyttä - 1.616-3Fedora Release Engineering - 1.616-2Petr Sabata - 1.616-1jkeating - 1.615-2Petr Sabata - 1.615-1Petr Sabata - 1.614-1Petr Sabata - 1.613-1Petr Pisar - 1.611-1Marcela Maslanova - 1.609-5Stepan Kasal - 1.609-4Stepan Kasal - 1.609-3Fedora Release Engineering - 1.609-2Stepan Kasal - 1.609-1Fedora Release Engineering - 1.607-2Marcela Maslanova - 1.607-1Tom "spot" Callaway - 1.601-4Fedora Release Engineering - 1.601-3Tom "spot" Callaway - 1.601-2Robin Norwood - 1.601-1Robin Norwood - 1.58-2Robin Norwood - 1.58-1Robin Norwood - 1.56-1Robin Norwood - 1.53-1Robin Norwood - 1.52-1Jason Vas Dias - 1.51-1Jesse Keating - 1.50-3Jesse Keating - 1.50-2.2Jesse Keating - 1.50-2.1Jason Vas Dias - 1.50-2Jason Vas Dias - 1.50-1Jesse Keating Jesse Keating Jose Pedro Oliveira - 1.48-4Warren Togami 1.48-3Robert Scheck 1.48-2Warren Togami 1.48-1Elliot Lee Elliot Lee Chip Turner 1.40-1Chip Turner W0ZgT>_ۋyr fǒۂPF0JW[y}pn4~+~ ݳ﵅~U~SA !+AHQ7r[O#ܱL^[BUz~oJr*ٿ^@%14o['f>([.+غ X]ة-|bE{rI$m(NH{Ii1cdup<0ZXv=K6Y$ q iTj\7w3$QW5prry IiJɜsaa(kĦq,|#E_ LE~"n!L=5z?קJ^&M&X܈?\= -1WNk\rF `SQ4Ԑ`v_m$ƨyy9m?.:7HgNrf'o3;Ocs⽪ eRy\zTi\ż.ŰKS>nNـ)9,-&$Ӎ:ElU"+4?oߛhO;VS1W8w{V bna%iozt8jؑB-' 1R)S"2 */Iw (?#V䨍7moJ}FfH@lx۬ ~6? NW#|I U^j_R乓r-"nTNNCs.7:n Ns1"]?%79Z'%Fs/9T,Wo I3wuO&ʤ-S\jN |';~nz{2\\W'iW3>GYǯVuŦmtu and dev->hard_header_len correctly (Stefano Brivio) [1548317] - [net] netfilter: nft_reject: restrict to INPUT/FORWARD/OUTPUT (Davide Caratti) [1549967] - [net] route: also update fnhe_genid when updating a route cache (Xin Long) [1523073] - [net] route: update fnhe_expires for redirect when the fnhe exists (Xin Long) [1523073] - [net] sctp: use right member as the param of list_for_each_entry (Xin Long) [1483445] - [net] sctp: reset owner sk for data chunks on out queues when migrating a sock (Xin Long) [1483445] - [net] gro: avoid reorders (Ivan Vecera) [1554456] - [net] Clarify dev_weight documentation for LRO and GRO_HW (Ivan Vecera) [1554456] - [net] Introduce NETIF_F_GRO_HW (Ivan Vecera) [1554456] - [net] mii, smsc: Make mii_ethtool_get_link_ksettings and smc_netdev_get_ecmd return void (Ivan Vecera) [1554965] - [net] mii: report 0 for unknown lp_advertising (Ivan Vecera) [1554965] - [net] mii: add generic function to support ksetting support (Ivan Vecera) [1554965] - [net] xfrm: fix stack access out of bounds with CONFIG_XFRM_SUB_POLICY (Sabrina Dubroca) [1551382] - [net] xfrm: xfrm_policy: silence compiler warning (Sabrina Dubroca) [1551382] - [net] xfrm: xfrm_policy: fix inline not at beginning of declaration (Sabrina Dubroca) [1551382] - [net] utils: generic inet_pton_with_scope helper (Ivan Vecera) [1551750] - [lib] kobject: Export kobj_ns_grab_current() and kobj_ns_drop() (Ivan Vecera) [1551750] - [lib] kobject: move EXPORT_SYMBOL() macros next to corresponding definitions (Ivan Vecera) [1551750] - [net] sctp: do not peel off an assoc from one netns to another one (Xin Long) [1520256] - [nxx%XbV$zases/7_3_4.php- update to 7.3.4RC1 new tag - add upstream patches for failed tests- update to 7.3.4RC1- Update to 7.3.3 - http://www.php.net/releases/7_3_3.php - add upstream patch for OpenSSL 1.1.1b- php-devel: drop dependency on libicu-devel- update to 7.3.3RC1 - adapt systzdata patch (v18)- pdo_oci: backport PDOStatement::getColumnMeta from 7.4- rebuild using libicu62- Update to 7.3.2 - http://www.php.net/releases/7_3_2.php- update to 7.3.2RC1 - update system tzdata patch for timelib 2018.01- cleanup for EL-8- test build for https://bugs.php.net/77430- Update to 7.3.1 - http://www.php.net/releases/7_3_1.php- update to 7.3.1RC1 - oci8 version is now 2.2.0- update to 7.3.0 GA - update FPM configuration from upstream- update to 7.3.0RC6- update to 7.3.0RC5- test build for https://github.com/php/php-src/pull/3652- update to 7.3.0RC4- update to 7.3.0RC3- update to 7.3.0RC2 - use oracle client library version 18.3- update to 7.3.0RC1 - with oniguruma 6.9.0- add upstream patch for openssl failing test- add upstream patch for F29- update to 7.3.0beta3- update to 7.3.0beta2 - bump API numbers- update to 7.3.0alpha4- update to 7.3.0alpha3- update to 7.3.0alpha2 new sources- update to 7.3.0alpha2 - bump php(zend-abi) and php(api) to 20180606 - revert 5dd1ef90caec3021e6ce55c8554e695edf641eaf- update to 7.3.0alpha1 - switch from pcre to pcre2- update to 7.2.7RC1- Update to 7.2.6 - http://www.php.net/releases/7_2_6.php- rebuild against EL 7.5- update to 7.2.6RC1- Update to 7.2.5 - http://www.php.net/releases/7_2_5.php- update to 7.2.5RC1- add upstream patch for oniguruma 6.8.1, FTBFS #1562583- Update to 7.2.4 - http://www.php.net/releases/7_2_4.php - FPM: update default pool configuration for process.dumpable- add file trigger to restart the php-fpm service when new pool or new extension installed (F27+)- update to 7.2.4RC1- devel: drop dependency on devtoolset- Update to 7.2.3 - http://www.php.net/releases/7_2_3.php - FPM: revert pid file removal - improve devel dependencies- rebuild for new tag and drop patch merged upstream - drop ldconfig scriptlets on F28- update to 7.2.3RC1 - adapt systzdata, fixheader and ldap_r patches - apply upstream patch for date ext- Update to 7.2.2 - http://www.php.net/releases/7_2_2.php- update to 7.2.2RC1 - define SOURCE_DATE_EPOCH for reproducible build- Update to 7.2.1 - http://www.php.net/releases/7_2_1.php- add upstream patch for https://bugs.php.net/75579- update to 7.2.1RC1- update to 7.2.0 GA- update to 7.2.0RC6- update to 7.2.0RC5- enable argon2 password hash- update to 7.2.0RC4 - oci8 version is now 2.1.8- dont obsolete php72-php-pecl-libsodium- update to 7.2.0RC3- RC3 test build - F27: php now requires php-fpm and start it with httpd / nginx- update builder from RHEL 7.3 to RHEL 7.4- update to 7.2.0RC2- add patch for EL-6, fix undefined symbol: sqlite3_errstr- update to 7.2.0RC1- test build from git snapshot - refresh configuration files, sync with upstream, drop .so suffix- test build from git snapshot- test build from git snapshot - adapt tzdata patch for timelib 2017.05beta7 - disable httpd MPM check- update to 7.2.0beta3- add patch for EL-6, fix undefined symbol: sqlite3_errstr - revert use of sqlite3_close_v2 on EL-6- update to 7.2.0beta2 - oci8 version is now 2.1.7- update to 7.2.0beta1 - oci8 version is now 2.1.6 - bump apiver and zendver to 20170718- test build - add sodium extension in new sub-package- update to 7.2.0alpha3- update to 7.2.0alpha2 - oci8 version is now 2.1.5 - use oracle instant client version 12.2- update to 7.2.0alpha1- new snapshot - use system oniguruma (F26)- new snapshot- test build for release process test, 7.2.0alpha0 - dba: add --with-lmdb build option- new snapshot- new snapshot, May the 4th be with you - enable PHP execution of .phar files, see #1117140- refresh- update to 7.2.0-dev - drop mcrypt subpackage (removed upstream)- Update to 7.1.4 - http://www.php.net/releases/7_1_4.php- Update to 7.1.4RC1- Update to 7.1.3 - http://www.php.net/releasexXc}W ،H$XHGIes #593641 - update bonding files (updated ifenslave tarball)- update to latest upstream - enables flowlabel feature (-F option)- fixes #557308 - arping ignores the deadline option- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- remake type conversions to gcc4.4 requirements- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- #455713 not accepted - suid is back- removed a dependency on libsysfs library in arping- Resolves: #455713 remove suid from ping - corrected typing error in man- major patch cleanup so it will be easier to get patches upstream - fix for #68212, previous fix actually didn't work for ping6 - renewed the ia64 align patches - update README.bonding - clear up the code from warnings - spec file cleanup- fix inconsistent behaviour of ping (#360881)- update to new upstream version- rebuild- correctly fix the -w option and return code of arping (#387881)- fix -Q option of ping6 (#213544)- fix absolute symlinks and character encoding for RELNOTES (#225909) - preserve file timestamps (#225909) - use %{?_smp_mflags} (#225909) - fix service rdisc stop removing of lock file- rebuild- resolves: #236725: ping does not work for subsecond intervals for ordinary user - resolves: #243197: RFE: Please sync ifenslave with current kernel - resolves: #246954: Initscript Review - resolves: #251124: can't build rdisc - OPEN_MAX undeclared- resolves: #235374: Update of iputils starts rdisc, breaking connectivity- Resolves: #234060: [PATCH] IDN (umlaut domains) support for ping and ping6 patch provided by Robert Scheck - upgarde to new upstream iputils-s20070202 - Resolves: #229995 - Resolves: #225909 - Merge Review: iputils - patches revision- Resolves: #218706 - now defines the destination address along RFC3484 - Resolves: #229630 - ifenslave(8) man page added - Resolves: #213716 - arping doesn't work on InfiniBand ipoib interfaces- new ifenslave/bonding documentation- tracepath doesn't continue past destination host (#174032) previous patch replaced by new one provided by option -c added- rebuilt- tracepath doesn't continue past destination host (#174032) - fix ifenslave, shows interface addresses - add RPM_OPT_FLAGS to ifenslave- fix ifenslave man page (#185223)- add PreReq: chkconfig (#182799,#182798)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- ping clean-up, added new ICMP warning messages- gcc patch, warnings cleaned-up- fix HOPLIMIT option for setsockopt() (#175471)- rebuilt- ifenslave.8 from debian.org - separate ifenslave to its own tarball- don't ship traceroute6, now part of traceroute package- add ping6 and tracepath6 manpages, fix attributes.- memset structure before using it (#168166)- fixed ping -f, flooding works again (#134859,#169141)- tracepath6 and tracepath fix, use getaddrinfo instead of gethostbyname(2) (#100778,#167735)- fixed arping timeout (#165715)- fixed arping buffer overflow (#163383)- fixed un-initialized "device" (#158914)- don't start rdisc as default (#154075)- rdisc init script added (#151614)- arping fix for infiniband (#150156)- return values fixed - patch from suse.de- ifenslave.c and README.bonding updated from kernel-2.6.8-1.521 (#136059)- spec file updated, source fixed (#135193)- rebuilt- Updated rh patch to enable PIE build of binaries.- Fixed bug with wrong return code check of inet_pton() in traceroute6 (#100684)- rebuilt- Fixed unaligned access problem on ia64 (#101417)- Don't use own headers, use glibc and kernheaders.- fix build with new glibc-kernheaders- rebuilt- Start icmp_seq from 0 instead of 1 (Conform with debian and Solaris #100609).- One more update to ifenslave.c- Updated ifenslave.c and README.bonding to latest version.- rebuilt- Bumped release and rebuilt- Fixed DNS lookup problems (#68212). - Added warning if binding problem failed on subinterface (#81640).- Removed bonding tarball and replaced it with ifenslave.c and README xXXdW$R95991b7852b855e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855229a86121a7d20f9be5d044688bf305b7364067319f56d64729d40740a3043ece3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855ae617ee381b69ce9e4c5d4264ebc7706f94b0feb13cd77c88cf238331883d94a455c676b0d7b08ece7d86950d998ff824608c33835f457cc9642dd8b3daf4db8e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855ae523ad52f2420080c52330b679b2bc43f9404d21db799e8694962d42f27ab2e0bc5fcbc61d5927fa4b58da73e7f45c7418040fc5d66bf583df533648ccb661fe3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855294a5876389d0562d36644ee1b8a32528ac1caab91cf1f4947734e8f53e6600da76c7d4e5b71c911d995a7e7890dee4a83550a4bb046910e56905efb02166584e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b85547240df6cbdc0b6b207e6b0d2a3e294f524ec472a9281d8bc14e264de16919d2855ffe3a40b3d089d2e254892348417c01e1b3004d1fe5d0ed2599c11408188efae487633b88f6f1efd5122cb613d217fba7cfc95375b71fbfd284c99751a7650f8b98d58c16d25e028067f47458245c1863d9ea44225166ac29c4c3fea6f8325306895e7e626217d2d9c3dc6d59a253b098471d56d3906ea45a23fd4f0d0114be0605d8e669b5af97618a688fc2f82e494c7cb110fda077e37fa60cc0ac398042e7cbb554ce090f94e60b24eea0d302b996edae537652c548bc38c783ad096af61f27bd17de546264aa58f40f3aafaac7021e0ef69c17f6b1b4cd7664a037ec74a4425dea96f40f2bfcdb5a69036cd020ba0c8a66f3fc0127fd47311fc2cc1cf61f27bd17de546264aa58f40f3aafaac7021e0ef69c17f6b1b4cd7664a037ec969da0bac82373d8813b2cab336491eb763b67e6aae76cd66964575fdd8db624f61f27bd17de546264aa58f40f3aafaac7021e0ef69c17f6b1b4cd7664a037ec354b5dd2e7f1ae1da8556a1fcec0365c1e464ad995c3db1797812704402bb1f1f61f27bd17de546264aa58f40f3aafaac7021e0ef69c17f6b1b4cd7664a037ecac907d079a9c0fd1bc3d7d8e5aa9898208763a6c98de289af46e3a7b1116c9f97c44edc12aab478e4456d0f9527b00a30af539124a959e896a3f53edac670207ac8fca0d5142181e2112e371baeed7b4fdf9e9e9cc4eb21dbafc7fb73a9a898df61f27bd17de546264aa58f40f3aafaac7021e0ef69c17f6b1b4cd7664a037ec90e37e5218a5db7cd52e08644cab3b864b633ceff2fa2885277284a27d5b3df0e6d83f291146c469c553a07117595d4da2f0942160fd77bc40d59a6731ac419c7c44edc12aab478e4456d0f9527b00a30af539124a959e896a3f53edac670207f61f27bd17de546264aa58f40f3aafaac7021e0ef69c17f6b1b4cd7664a037ecb9829ef29c22a89ce204bc835f1fb58492131010c97dd4428457664c9d05d8d6f61f27bd17de546264aa58f40f3aafaac7021e0ef69c17f6b1b4cd7664a037ecef939fa79c93c1938530c66ec1423cd7613e4f86b8223ec20158eadf65806a11ad875f6c8741d5a1b981b749ed3c7e0106ff07b9e2ee8ae1bc0f6c312eccb108e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855../sbin/sendmail.sendmail../sbin/sendmail.sendmail../sbin/makemap../sbin/sendmail.sendmail../sbin/sendmail.sendmail../sbin/sendmail.sendmail@@@@@@@@@@@@@BBBBBBB@rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootsmmsprootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootsmmsprootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootsmmsprootmailsendmail-8.14.7-6.el7.src.rpmxXeJVXG$HXGYGWGal - 12:4.2.5-45Zdenek Dohnal - 12:4.2.5-44Zdenek Dohnal - 12:4.2.5-43Jiri Popelka - 12:4.2.5-42Jiri Popelka - 12:4.2.5-41Jiri Popelka - 12:4.2.5-40Jiri Popelka - 12:4.2.5-39Jiri Popelka - 12:4.2.5-38Jiri Popelka - 12:4.2.5-37Jiri Popelka - 12:4.2.5-36Jiri Popelka - 12:4.2.5-35Jiri Popelka - 12:4.2.5-34Jiri Popelka - 12:4.2.5-33Jiri Popelka - 12:4.2.5-32Jiri Popelka - 12:4.2.5-31Jiri Popelka - 12:4.2.5-30Jiri Popelka - 12:4.2.5-29Jiri Popelka - 12:4.2.5-28Daniel Mach - 12:4.2.5-27Jiri Popelka - 12:4.2.5-26Daniel Mach - 12:4.2.5-25Jiri Popelka - 12:4.2.5-24Jiri Popelka - 12:4.2.5-23Tomas Hozza - 12:4.2.5-22Pavel Šimerda - 12:4.2.5-21Pavel Šimerda - 12:4.2.5-20Jiri Popelka - 12:4.2.5-19Jiri Popelka - 12:4.2.5-18Jiri Popelka - 12:4.2.5-17Tomas Hozza - 12:4.2.5-16Jiri Popelka - 12:4.2.5-15Jiri Popelka - 12:4.2.5-14Jiri Popelka - 12:4.2.5-13Adam Williamson - 12:4.2.5-12Jiri Popelka - 12:4.2.5-11Adam Tkac - 12:4.2.5-10Tomas Hozza - 12:4.2.5-9Jiri Popelka - 12:4.2.5-8Jiri Popelka - 12:4.2.5-7Fedora Release Engineering - 12:4.2.5-6Jiri Popelka - 12:4.2.5-5Jiri Popelka - 12:4.2.5-4Jiri Popelka - 12:4.2.5-3Jiri Popelka - 12:4.2.5-2Jiri Popelka - 12:4.2.5-1Jiri Popelka - 12:4.2.5-0.3.rc1Jiri Popelka - 12:4.2.5-0.2.rc1Jiri Popelka - 12:4.2.5-0.1.rc1Jiri Popelka - 12:4.2.4-23.P2Jiri Popelka - 12:4.2.4-22.P2Jiri Popelka - 12:4.2.4-21.P2Jiri Popelka - 12:4.2.4-20.P2Jiri Popelka - 12:4.2.4-19.P2Adam Tkac - 12:4.2.4-18.P2Jiri Popelka - 12:4.2.4-17.P2Jiri Popelka - 12:4.2.4-16.P2Tomas Hozza - 12:4.2.4-15.P2Tomas Hozza - 12:4.2.4-14.P1Tomas Hozza - 12:4.2.4-13.P1Tomas Hozza - 12:4.2.4-12.P1Jiri Popelka - 12:4.2.4-11.P1Jiri Popelka - 12:4.2.4-10.P1Fedora Release Engineering - 12:4.2.4-9.P1Tomas Hozza - 12:4.2.4-8.P1Tomas Hozza - 12:4.2.4-7.P1Jiri Popelka - 12:4.2.4-6Tomas Hozza - 12:4.2.4-5Jiri Popelka - 12:4.2.4-4Tomas Hozza - 12:4.2.4-3Jiri Popelka - 12:4.2.4-2Jiri Popelka - 12:4.2.4-1Jiri Popelka - 12:4.2.4-0.8.rc2Jiri Popelka - 12:4.2.4-0.7.rc2Jiri Popelka - 12:4.2.4-0.6.rc2Jiri Popelka - 12:4.2.4-0.5.rc1Jiri Popelka - 12:4.2.4-0.4.rc1Jiri Popelka - 12:4.2.4-0.3.b1Jiri Popelka - 12:4.2.4-0.2.b1Jiri Popelka - 12:4.2.4-0.1.b1Jiri Popelka - 12:4.2.3-25.P2Jiri Popelka - 12:4.2.3-24.P2Jiri Popelka - xHXf;W!(ku${kujulun the -doc subpackage - Resolves: #529030- Several fixes to support PySide - Resolves: #520087 - GCC 4.4 name resolution fixes for GIL - Resolves: #526834- Disable long double support for ARM- bump release and rebuild as the package was linked with an old libicu during the mass rebuild on s390x- Make it to be usable with openssl-1.0- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Drop file list for main "boost" package, which was inadvertently left in. - Add thread sub-package to capture omitted boost_thread. - Add upstream patch to make boost_filesystem compatible with C++0x. - Resolves: #496188 - Resolves: #509250- Apply patch from Caolan McNamara - Resolves: #500030 function_template bug is back...- Update release.- Fixes for rpmlint.- Split up boost package to sub-packages per library - Resolves: #496188- Rebase to 1.39.0. - Add --with docs_generated. - #225622: Substitute optflags at prep time instead of RPM_OPT_FLAGS.- Rebuild for libicu bump.- Apply a SMP patch from Stefan Ring - Apply a workaround for "cannot appear in a constant-expression" in dynamic_bitset library. - Resolves: #491537- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Apply a unneccessary_iostreams patch from Caolan McNamara - Fix soname patch so that it applies with fuzz=0. Use fuzz=0 option in spec file just like ordinary patches do. - Resolves: #479409- Apply a function_template patch from Caolan McNamara - Resolves: #477131- Fix rpmlint rpath errors. - Fix rpmlint warnings on tabs and spaces. - Bump SONAME to 4- Rebase to 1.37.0.- Rebase to 1.36.0.- Fix gcc43 patch to apply cleanly under --fuzz=0 - Resolves: #465003- Rebase to 1.36.0.beta1 - Drop boost-regex.patch and portions of boost-gcc43.patch, port the rest - Automate SONAME tracking and bump SONAME to 4 - Adjust boost-configure.patch to include threading=single,multi explicitly- Fix "changes meaning of keywords" in boost date_time - Related: #450718- fix license tag- Change devel-static back to static. - Related: #225622- Install library doc files - Revamp %install phase to speed up overall build time - Some cleanups per merge review - Resolves: #437032- Fix "changes meaning of keywords" in boost python - Resolves: #432694- Fix "changes meaning of special_values_parser" in boost date_time - Resolves: #432433- Fixes for GCC 4.3 - Resolves: #431609- Fixes for boost.regex (rev 42674).- (#283771: Linking against boost libraries fails).- Rebuild.- Rebuild for icu 3.8 bump.- SONAME to 3.- Update to boost_1_34_1. - Source via http. - Philipp Thomas fix for RPM_OPT_FLAGS - Philipp Thomas fix for .so sym links. - (#225622) Patrice Dumas review comments.- Update to boost_1_34_1_RC1.- (#225622: Merge Review: boost) Change static to devel-static.- (#233523: libboost_python needs rebuild against python 2.5) Use patch.- (#225622: Merge Review: boost) Source to http. BuildRoot to preferred value. PreReq to post/postun -p Clarified BSL as GPL-Compatible, Free Software License. Remove Obsoletes. Add Provides boost-python. Remove mkdir -p $RPM_BUILD_ROOT%{_docdir} Added periods for decription text. Fix Group field. Remove doc Requires boost. Preserve timestamps on install. Use %defattr(-, root, root, -) Added static package for .a libs. Install static libs with 0644 permissions. Use %doc for doc files.- Update to boost.RC_1_34_0 snapshot as of 2007-01-19. - Modify build procedures for boost build v2. - Add *-mt variants for libraries, or at least variants that use threads (regex and thread).- (#182414: boost: put tests in %check section) via Rex Dieter - Fix EVR with %{?dist} tag via Gianluca Sforna- (#154784: boost-debuginfo package is empty)- (#205866: Revert scanner.hpp change.)- (#205866: boost::spirit generates warnings with -Wshadow) - (#205863: serialization lib generates warnings) - (#204326: boost RPM missing dependencies) - (#193465: [SIGNAL/BIND] Regressions with GCC 4.1) - BUILD_FLAGS, add, to see actual compixXgU7<$=<<<  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdafafbebebgbgcacacscsdadadedeeleleoeoeseseteteueufififrfrgagaglglhrhrhuhuiaiaididititjajakkkkkokolglgltltmsmsnbnbnlnlplplptptptptrororuruskskslslsvsvtrtrukukvivizhzhzhzh8.22-24.el7_9.28.22-24.el7_9.28.22-24.el7_9.28.22-24.el7_9.24:8.22-24.el7_9.28.22-24.el7_9.28.22-24.el7_9.28.22-24.el7_9.2 4:8.22-24.el7_9.24.1.92.0.123.32.0.218.13x(XhWsƒ$RƒÃ to 7.3.1 - http://www.php.net/releases/7_3_1.php- update to 7.3.1RC1 - oci8 version is now 2.2.0- update to 7.3.0 GA - update FPM configuration from upstream- update to 7.3.0RC6- update to 7.3.0RC5- test build for https://github.com/php/php-src/pull/3652- update to 7.3.0RC4- update to 7.3.0RC3- update to 7.3.0RC2 - use oracle client library version 18.3- update to 7.3.0RC1 - with oniguruma 6.9.0- add upstream patch for openssl failing test- add upstream patch for F29- update to 7.3.0beta3- update to 7.3.0beta2 - bump API numbers- update to 7.3.0alpha4- update to 7.3.0alpha3- update to 7.3.0alpha2 new sources- update to 7.3.0alpha2 - bump php(zend-abi) and php(api) to 20180606 - revert 5dd1ef90caec3021e6ce55c8554e695edf641eaf- update to 7.3.0alpha1 - switch from pcre to pcre2- update to 7.2.7RC1- Update to 7.2.6 - http://www.php.net/releases/7_2_6.php- rebuild against EL 7.5- update to 7.2.6RC1- Update to 7.2.5 - http://www.php.net/releases/7_2_5.php- update to 7.2.5RC1- add upstream patch for oniguruma 6.8.1, FTBFS #1562583- Update to 7.2.4 - http://www.php.net/releases/7_2_4.php - FPM: update default pool configuration for process.dumpable- add file trigger to restart the php-fpm service when new pool or new extension installed (F27+)- update to 7.2.4RC1- devel: drop dependency on devtoolset- Update to 7.2.3 - http://www.php.net/releases/7_2_3.php - FPM: revert pid file removal - improve devel dependencies- rebuild for new tag and drop patch merged upstream - drop ldconfig scriptlets on F28- update to 7.2.3RC1 - adapt systzdata, fixheader and ldap_r patches - apply upstream patch for date ext- Update to 7.2.2 - http://www.php.net/releases/7_2_2.php- update to 7.2.2RC1 - define SOURCE_DATE_EPOCH for reproducible build- Update to 7.2.1 - http://www.php.net/releases/7_2_1.php- add upstream patch for https://bugs.php.net/75579- update to 7.2.1RC1- update to 7.2.0 GA- update to 7.2.0RC6- update to 7.2.0RC5- enable argon2 password hash- update to 7.2.0RC4 - oci8 version is now 2.1.8- dont obsolete php72-php-pecl-libsodium- update to 7.2.0RC3- RC3 test build - F27: php now requires php-fpm and start it with httpd / nginx- update builder from RHEL 7.3 to RHEL 7.4- update to 7.2.0RC2- add patch for EL-6, fix undefined symbol: sqlite3_errstr- update to 7.2.0RC1- test build from git snapshot - refresh configuration files, sync with upstream, drop .so suffix- test build from git snapshot- test build from git snapshot - adapt tzdata patch for timelib 2017.05beta7 - disable httpd MPM check- update to 7.2.0beta3- add patch for EL-6, fix undefined symbol: sqlite3_errstr - revert use of sqlite3_close_v2 on EL-6- update to 7.2.0beta2 - oci8 version is now 2.1.7- update to 7.2.0beta1 - oci8 version is now 2.1.6 - bump apiver and zendver to 20170718- test build - add sodium extension in new sub-package- update to 7.2.0alpha3- update to 7.2.0alpha2 - oci8 version is now 2.1.5 - use oracle instant client version 12.2- update to 7.2.0alpha1- new snapshot - use system oniguruma (F26)- new snapshot- test build for release process test, 7.2.0alpha0 - dba: add --with-lmdb build option- new snapshot- new snapshot, May the 4th be with you - enable PHP execution of .phar files, see #1117140- refresh- update to 7.2.0-dev - drop mcrypt subpackage (removed upstream)- Update to 7.1.4 - http://www.php.net/releases/7_1_4.php- Update to 7.1.4RC1- Update to 7.1.3 - http://www.php.net/releases/7_1_3.php- fix interbase build on F26- Update to 7.1.3RC1- Update to 7.1.2 - http://www.php.net/releases/7_1_2.php- Update to 7.1.2RC1 (new sources)- Update to 7.1.2RC1- EL-7: add patch for https://bugs.php.net/73956 - switch back to gcc 6.2- EL-7: rebuild using gcc 4.8 instead of 6.2 because of https://bugzilla.redhat.com/1414348- Update to 7.1.1 - http://www.php.net/releases/7_1_1.php- Update to 7.1.1RC1- test optimized build using GCC 6.2- Update to 7.1.0 - http://www.php.net/releases/7_1_0.php - use bundled pcre library 8.38 on EL-7 - disable pcre.jit evexXi:W$ju$zjuiukut-1.47.0, adding three new header-only components (Geometry, Phoenix, Ratio) and a new library (Chrono).- Fix compile on ARM platforms- Yet another way to pass -DBOOST_LIB_INSTALL_DIR to cmake. Passing via CMAKE_CXX_FLAGS for some reason breaks when rpm re-quotes the expression as a result of %{optflags} expansion. - Related: #667294- Rebuild for mpich2 soname bump- Merged the latest changes from the bug-fix release of Boost-1.46- rebuild for icu 4.6- Merged the latest changes from the now final release of Boost-1.46- spirit.patch: Fix a problem in using boost::spirit with utf-8 strings. Thanks to Hicham HAOUARI for digging up the fix.- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Package 1.46.0-beta1 - Reintroduce the soname patch - unordered-cctor.patch: Add copy constructors and assignment operators when using rvalue references - signals-erase.patch: Pass const_iterator to map::erase to avoid ambigous overload vs. templatized value_type ctor - Related: #656410- Integrated Petr's work to fix missing Boost.Filesystem V3 issue - Resolves: #667740- Don't override CXXFLAGS with -DBOOST_IOSTREAMS_USE_DEPRECATED - Resolves: #667294- Add boost-random DSOs - Resolves: #665679- Build with support for iostreams deprecated functions - Resolves: #654480- also package build-system.jam in boost-build- add boost-build, boost-jam subpackages- Rebuild.- Split the CMake-buildable tar-ball into pristine upstream tar-ball and CMake framework patch- Merged the latest changes from the now final release of Boost-1.44- Patched header file in boost/random/detail. Resolves: #621631- Added missing header files in boost/random/detail. Resolves: #619869- Rebuilt for https://fedoraproject.org/wiki/Features/Python_2.7/MassRebuild- Rebuild.- Upstream update: Boost-1.44 with CMake enabled - Resolves: #607615- Rebuilt for https://fedoraproject.org/wiki/Features/Python_2.7/MassRebuild- Turn on mpich2 on s390. Add arm to the list of arches that openmpi doesn't support.- Don't distribute cmake support files. - Related: #597020- don't build with mpich2/openmpi on s390/s390x- Add an upstream patch that fixes computation of CRC in zlib streams. - Resolves: #590205- -devel: own %{_datadir}/cmake/%{name}/ - -devel: Requires: cmake (for %{_datadir}/cmake ownership)- rebuild for icu- Add a patch for serialization of shared pointers to non polymorphic types- More subpackage interdependency adjustments - boost doesn't bring in the MPI stuff. Instead, $MPI-devel does. It needs to, so that the symbolic links don't dangle. - boost-graph-$MPI depends on boost-$MPI so that boost-mpich2 doesn't satisfy the SONAME dependency of boost-graph-openmpi. - Resolves: #559009- Various fixes on the specification - Resolves: #559009- Introduce support for both OpenMPI and MPICH2 - Resolves: #559009- Add a patch to build mapnik - Resolves: #558383- Generalize the soname selection- Further split the Boost.MPI sub-package into boost-mpi and boost-mpi-python - Changed the description of Boost.MPI according to the actual dependency (MPICH2 rather than OpenMPI) - Added a few details on the generation of the mpi.so library- Replace a boost-math subpackage with a stub - Drop _cmake_lib_suffix and CMAKE_INSTALL_PREFIX magic, the rpm macro does that for us - Drop LICENSE from the umbrella package - Drop obsolete Obsoletes: boost-python and boost-doc <= 1.30.2- Don't package generated debug libs, even with (-DCMAKE_BUILD_TYPE=RelWithDebInfo | Release). - Update and include boost-cmake-soname.patch. - Uncomment ctest. - Fix up --with tests to run tests.- Switched off the delivery into a versioned sub-directory- Boost-CMake upstream integration- Rebase to 1.41.0 - Set build type to RelWithDebInfo - Resolves: #533922- Add support for the Boost.MPI sub-package - Build with CMake (https://svn.boost.org/trac/boost/wiki/CMake) - Resolves: #529563- Move comment in Patch13 out of line- translate_exception.hpp misses a include - Related: #537612- Package index.html ixXjV,UF$VFG|vۖ^ވ aP2(BI` T_K=$ƨg𞷕UM*=5!*I FO y0yW=kN=NU!XNaBpăL2VRyE4ēUz[]J /E} |heri-3m!j[YKHVw:uK`{%ya Į0hMЕ2[dǺEN;= S# HFMkBOpvN( e 2n@nOjBchqVDwB.f#Ksd;z)I(Ej➚XMdh4d4Eo͕BcOuhgᜍJ2>ɟܻkaq0]b% .^p ,Q,0A h&nR'/Y5g >'|ccXȁvg].Ȍֽ+hjYr"(jEh-RTn;ky9H]}9aa7fc6a82bd39d5274171335f19172e0b6770c8b"Tb385330 1417284] - [netdrv] mlx5: Use ktime_get_ns() (Don Dutile) [1385330 1417284] - [netdrv] mlx5: Fix wait_vital for VFs and remove fixed sleep (Don Dutile) [1385330 1417284] - [netdrv] mlx5: Fix incorrect page count when in internal error (Don Dutile) [1385330 1417284] - [netdrv] mlx5: Avoid calling sleeping function by the health poll thread (Don Dutile) [1385330 1417284] - [netdrv] mlx5: Fix teardown errors that happen in pci error handler (Don Dutile) [1385330 1417284] - [netdrv] mlx5e: Reorganize ethtool statistics (Don Dutile) [1417284] - [netdrv] mlx5e: Fix number of PFC counters reported to ethtool (Don Dutile) [1417284] - [netdrv] mlx5e: Prevent adding the same vxlan port (Don Dutile) [1417284] - [netdrv] mlx5e: Check for BlueFlame capability before allocating SQ uar (Don Dutile) [1417284] - [netdrv] mlx5e: Change enum to better reflect usage (Don Dutile) [1417284] - [netdrv] mlx5: Add ConnectX-5 PCIe 4.0 to list of supported devices (Don Dutile) [1385330 1417284] - [netdrv] mlx5: Update command strings (Don Dutile) [1385330 1417284] - [netdrv] mlx5: use mlx5_buf_alloc_node instead of mlx5_buf_alloc in mlx5_wq_ll_create (Don Dutile) [1385330 1417284] - [infiniband] ib/srpt: Reduce QP buffer size (Don Dutile) [1417284] - [rdma] ib/rdmavt: Correct qp_priv_alloc() return value test (Don Dutile) [1385848 1417284] - [infiniband] ib/hfi1: Don't zero out qp->s_ack_queue in rvt_reset_qp (Don Dutile) [1382806 1417284] - [infiniband] ib/hfi1: Fix deadlock with txreq allocation slow path (Don Dutile) [1382806 1417284] - [infiniband] ib/mlx4: Prevent cross page boundary allocation (Don Dutile) [1385329 1417284] - [infiniband] ib/mlx4: Fix memory leak if QP creation failed (Don Dutile) [1385329 1417284] - [infiniband] ib/mlx4: Verify port number in flow steering create flow (Don Dutile) [1385329 1417284] - [infiniband] ib/mlx4: Fix error flow when sending mads under SRIOV (Don Dutile) [1385329 1417284] - [infiniband] ib/mlx4: Fix the SQ size of an RC QP (Don Dutile) [1385329 1417284] - [netdrv] ib/mlx5: Fix post send fence logic (Don Dutile) [1385330 1417284] - [infiniband] ib/core: Fix false search of the IB_SA_WELL_KNOWN_GUID (Don Dutile) [1417284] - [infiniband] ib/core: Fix no default GIDs when netdevice reregisters (Don Dutile) [1417284] - [netdrv] mlx4_en: Avoid unregister_netdev at shutdown flow (Don Dutile) [1385329 1417284] - [net] rds: fix coding style issues (Don Dutile) [1417284] - [net] rds: tcp: rds_tcp_accept_one() should transition socket from RESETTING to UP (Don Dutile) [1417284] - [infiniband] ib/hfi1: Send a pkey change event on driver pkey update (Don Dutile) [1382806 1417284] - [infiniband] ib/hfi1: Remove FULL_MGMT_P_KEY from pkey table at link up (Don Dutile) [1382806 1417284] - [infiniband] ib/hfi1: Fix potential buffer overflow (Don Dutile) [1382806 1417284] - [infiniband] ib/hfi1: Fix potential NULL ptr dereference (Don Dutile) [1382806 1417284] - [infiniband] ib/qib: Prevent context loss (Don Dutile) [1381986 1417284] - [infiniband] ib/hfi1: Prevent context loss (Don Dutile) [1382806 1417284] - [infiniband] ib/hfi1: Increase packet egress timeout (Don Dutile) [1382806 1417284] - [infiniband] ib/rdmavt: Correct warning during QPN allocation (Don Dutile) [1385848 1417284] - [infiniband] ib/rdmavt: Correct required callback functions for MODIFY_QP (Don Dutile) [1385848 1417284] - [infiniband] ib/hfi1: Fix credit return threshold adjustment (Don DutixXkW$Puires xml- Update to 5.6.4 http://www.php.net/releases/5_6_4.php- update to 5.6.4RC1- add embedded sub package - filter all libraries to avoid provides- FPM: add upstream patch for https://bugs.php.net/68421 access.format=R doesn't log ipv6 address - FPM: add upstream patch for https://bugs.php.net/68420 listen=9000 listens to ipv6 localhost instead of all addresses - FPM: add upstream patch for https://bugs.php.net/68423 will no longer load all pools- Update to PHP 5.6.3 http://php.net/releases/5_6_3.php- update to 5.6.3RC1 - new version of systzdata patch, fix case sensitivity - ignore Factory in date tests - disable opcache.fast_shutdown in default config - add php56-cgi command in base system- Update to PHP 5.6.2 http://php.net/releases/5_6_2.php- Update to PHP 5.6.1 http://php.net/releases/5_6_1.php - use default system cipher list by Fedora policy http://fedoraproject.org/wiki/Changes/CryptoPolicy - add system php library to default include_path- enable libvpx on EL 6 (with libvpx 1.3.0) - add php56-phpdbg command in base system- PHP 5.6.0 is GA - add lsphp56 command in base system- initial spec for PHP 5.6 as Software Collection - adapted from php 5.6 spec file from remi repository - adapted from php 5.5 spec file from rhscl 1.1- fileinfo: fix out-of-bounds memory access CVE-2014-2270 - fileinfo: fix extensive backtracking CVE-2013-7345- gd: fix NULL deref in imagecrop CVE-2013-7327 - gd: drop vpx support, fix huge memory consumption #1075201- fix patch name - fix memory leak introduce in patch for CVE-2014-1943 - fix heap-based buffer over-read in DateInterval CVE-2013-6712- fix infinite recursion in fileinfo CVE-2014-1943- fix heap overflow vulnerability in imagecrop CVE-2013-7226- allow multiple paths in ini_scan_dir #1058161- add security fix for CVE-2013-6420- rebuild with test enabled - add dependency on php-pecl-jsonc- update to PHP 5.5.6 - buildstrap build- update to PHP 5.5.5 - mod_php only for httpd24- update to PHP 5.5.4 - improve security, use specific soap.wsdl_cache_dir use /var/lib/php/wsdlcache for mod_php and php-fpm - sync short_tag comments in php.ini with upstream - relocate RPM macro- update to PHP 5.5.3 - improve system libzip patch - fix typo and add missing entries in php.ini- update to PHP 5.5.1 for php55 SCL- rebuild for new httpd-mmn value- remove ZTS conditional stuf for ligibility - add mod_php for apache 2.4 (from httpd24 collection)- improve mod_php, pgsql and ldap description - add missing man pages (phar, php-cgi) - add provides php(pdo-abi) for consistency with php(api) and php(zend-abi) - use %__isa_bits instead of %__isa in ABI suffix #985350- add security fix for CVE-2013-4113 - add missing ASL 1.0 license- run tests during build- rebase to 5.4.16 - fix hang in FindTishriMolad(), #965144 - patch for upstream Bug #64915 error_log ignored when daemonize=0 - patch for upstream Bug #64949 Buffer overflow in _pdo_pgsql_error, #969103 - patch for upstream bug #64960 Segfault in gc_zval_possible_root- remove wrappers in /usr/bin (#966407)- rebuild for libjpeg (instead of libjpeg_turbo) - fix unowned dir %{_datadir}/fpm and %{_libdir}/httpd (#956221)- update to 5.4.14 - clean old deprecated options- update to 5.4.13 - security fixes for CVE-2013-1635 and CVE-2013-1643 - make php-mysql package optional (and disabled) - make ZTS build optional (and disabled) - always try to load mod_php (apache warning is usefull) - Hardened build (links with -z now option) - Remove %config from /etc/rpm/macros.php- update to 5.4.11 - fix php.conf to allow MultiViews managed by php scripts- update to 5.4.10 - remove patches merged upstream - drop "Configure Command" from phpinfo output - prevent php_config.h changes across (otherwise identical) rebuilds- update to 5.4.9- fix php.conf- filter private shared in _httpd_modir - improve system libzip patch to use pkg-config - use _httpd_contentdir macro and fix php.gif path - switch back to upstream generated scanner/parser - use system pcre only when recent enough- improvesxhXlWp$date to 5.2.3 (thanks to Jeff Sheltren)- fix php-pdo *_arg_force_ref global symbol abuse (#216125)- rebuild against uw-imap-devel- update to 5.2.2 - synch changes from upstream recommended php.ini- enable SASL support in LDAP extension (#205772)- drop mime_magic extension (deprecated by php-pecl-Fileinfo)- fix regression in str_{i,}replace (from upstream)- update to 5.2.1 - add Requires(pre) for httpd - trim %changelog to versions >= 5.0.0- bump default memory_limit to 32M (#220821) - mark config files noreplace again (#174251) - drop trailing dots from Summary fields - use standard BuildRoot - drop libtool15 patch (#226294)- add php(api), php(zend-abi) provides (#221302) - package /usr/share/php and append to default include_path (#225434)- fix filter.h installation path - fix php-zend-abi version (Remi Collet, #212804)- rebuild again- rebuild for net-snmp soname bump- build json and zip shared, in -common (Remi Collet, #215966) - obsolete php-json and php-pecl-zip - build readline extension into /usr/bin/php* (#210585) - change module subpackages to require php-common not php (#177821)- provide php-zend-abi (#212804) - add /etc/rpm/macros.php exporting interface versions - synch with upstream recommended php.ini- update to 5.2.0 (#213837) - php-xml provides php-domxml (#215656) - fix php-pdo-abi provide (#214281)- rebuild for curl soname bump - add build fix for curl 7.16 API- from upstream: add safety checks against integer overflow in _ecalloc- update to 5.1.6 (security fixes) - bump default memory_limit to 16M (#196802)- rebuild- Provide php-posix (#194583) - only provide php-pcntl from -cli subpackage - add missing defattr's (thanks to Matthias Saou)- move Obsoletes for php-openssl to -common (#194501) - Provide: php-cgi from -cli subpackage- split out php-cli, php-common subpackages (#177821) - add php-pdo-abi version export (#193202)- rebuilt for new libnetsnmp- provide mod_php (#187891) - provide php-cli (#192196) - use correct LDAP fix (#181518) - define _GNU_SOURCE in php_config.h and leave it defined - drop (circular) dependency on php-pear- update to 5.1.4- update to 5.1.3- provide php-api (#183227) - add provides for all builtin modules (Tim Jackson, #173804) - own %{_libdir}/php/pear for PEAR packages (per #176733) - add obsoletes to allow upgrade from FE4 PDO packages (#181863)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild for new libc-client soname- only build xmlreader and xmlwriter shared (#177810)- update to 5.1.2- rebuild again- rebuild for new net-snmp- enable short_open_tag in default php.ini again (#175381)- rebuilt- require net-snmp for php-snmp (#174800)- add /usr/share/pear back to hard-coded include_path (#174885)- rebuild for httpd 2.2- update to 5.1.1 - remove pear subpackage - enable pdo extensions (php-pdo subpackage) - remove non-standard conditional module builds - enable xmlreader extension- rebuilt against new openssl- pear: update to XML_RPC 1.4.4, XML_Parser 1.2.7, Mail 1.1.9 (#172528)- rebuild for new libnetsnmp- update to 5.0.5 - add fix for upstream #34435 - devel: require autoconf, automake (#159283) - pear: update to HTTP-1.3.6, Mail-1.1.8, Net_SMTP-1.2.7, XML_RPC-1.4.1 - fix imagettftext et al (upstream, #161001)- ldap: restore ldap_start_tls() function- disable RPATHs in shared extensions (#156974)- build simplexml_import_dom even with shared dom (#156434) - prevent truncation of copied files to ~2Mb (#155916) - install /usr/bin/php from CLI build alongside CGI - enable sysvmsg extension (#142988)- prevent build of builtin dba as well as shared extension- split out dba and bcmath extensions into subpackages - BuildRequire gcc-c++ to avoid AC_PROG_CXX{,CPP} failure (#155221) - pear: update to DB-1.7.6 - enable FastCGI support in /usr/bin/php-cgi (#149596)- build /usr/bin/php with the CLI SAPI, and add /usr/bin/php-cgi, built with the CGI SAPI (thanks to Edward Rudd, #137704) - add php(1) man page for CLI - fix more test cases to use -n when invokxoXmW1ʃ$Zʃ˃Ƀi@remirepo.net> - 8.0.0~rc4-37Remi Collet - 8.0.0~rc3-36Remi Collet - 8.0.0~rc2-35Remi Collet - 8.0.0~rc1-34Remi Collet - 8.0.0~beta4-33Remi Collet - 8.0.0~beta4-32Remi Collet - 8.0.0~beta3-31Remi Collet - 8.0.0~beta2-30Remi Collet - 8.0.0~beta2-29Remi Collet - 8.0.0~beta1-28Remi Collet - 8.0.0~beta1-27Remi Collet - 8.0.0~alpha3-26Remi Collet - 8.0.0~alpha2-25Remi Collet - 8.0.0~alpha2-24Remi Collet - 8.0.0~alpha2-23Remi Collet - 8.0.0~alpha1-22Remi Collet - 8.0.0~alpha1-21Remi Collet - 8.0.0~alpha1-20Remi Collet - 8.0.0~DEV.20200615-19Remi Collet - 8.0.0~DEV.20200609-18Remi Collet - 8.0.0~DEV.20200608-17Remi Collet - 8.0.0~DEV.20200602-16Remi Collet - 8.0.0~DEV.20200527-15Remi Collet - 8.0.0~DEV.20200526-14Remi Collet - 8.0.0~DEV.20200526-13Remi Collet - 8.0.0~DEV.20200519-12Remi Collet - 8.0.0~DEV.20200519-11Remi Collet - 8.0.0~DEV.20200513-10Remi Collet - 8.0.0~DEV.20200513-9Remi Collet - 8.0.0~DEV.20200504-8Remi Collet - 8.0.0~DEV.20200428-7Remi Collet - 8.0.0~DEV.20200427-6Remi Collet - 8.0.0~DEV.20200427-5Remi Collet - 8.0.0~DEV.20200422-4Remi Collet - 8.0.0~DEV.20200415-3Remi Collet - 8.0.0~DEV.20200409-2Remi Collet - 8.0.0~DEV.20200409-1Remi Collet - 7.4.5~RC1-1Remi Collet - 7.4.4-1Remi Collet - 7.4.4~RC1-1Remi Collet - 7.4.3-1Remi Collet - 7.4.3~RC1-1Remi Collet - 7.4.2-2Remi Collet - 7.4.2-1Remi Collet - 7.4.2~RC1-1Remi Collet - 7.4.1-1Remi Collet - 7.4.1~RC1-1Remi Collet - 7.4.0-1Remi Collet - 7.4.0~rc6-34Remi Collet - 7.4.0~rc5-33Remi Collet - 7.4.0~rc4-32Remi Collet - 7.4.0~rc4-31Remi Collet - 7.4.0~rc4-30Remi Collet - 7.4.0~rc4-29Remi Collet - 7.4.0~rc4-28Remi Collet - 7.4.0~rc3-27Remi Collet - 7.4.0~rc3-26Remi Collet - 7.4.0~rc3-25Remi Collet - 7.4.0~rc3-24Remi Collet - 7.4.0~rc3-23Remi Collet - 7.4.0~rc2-22Remi Collet - 7.4.0~rc2-21Remi Collet - 7.4.0~rc2-19Remi Collet - 7.4.0~rc1-18Remi Collet - 7.4.0~beta4-17Remi Collet - 7.4.0~beta2-16Remi Collet - 7.4.0~beta1-15Remi Collet - 7.4.0~beta1-14Remi Collet - 7.4.0~alpha3-13Remi Collet - 7.4.0~alpha3-12Remi Collet - 7.4.0~alpha2-11Remi Collet - 7.4.0~alpha1-10Remi Collet - 7.4.0~alpha1-9Remi Collet - 7.4.0~alpha1-8Remi Collet - 7.4.0~DEV.20190612-7Remi Collet - 7.4.0~DEV.20190605-6Remi Collet - 7.4.0~DEV.20190529-5Remi Collet - 7.4.0~DEV.20190528-4Remi Collet - 7.4.0~DEV.20190522-3Remi Collet - 7.4.0~DEV.20190521-2Remi Collet - 7.4.0~DEV.20190521-1Remi Collet - 7.4xX_XnVh$ f tch to fix improper LIBPTHREAD macro in the pkgconfig file: - upstream issue- Fix applying the LIBPTHREAD patch. (Thanks to Matthieu Saulnier.)- Add patch to fix improper LIBPTHREAD macro in the pkgconfig file: + fix-LIBPTHREAD-macro.patch - Resolves: #795582 (qrencode-devel: Malformed pkgconfig file causes build to fail ("@LIBPTHREAD@: No such file or directory"))- update to 3.2.0 - remove BuildRoot tag in spec file - remove "rm -rf $RPM_BUILD_ROOT" at the beginning of %install section - remove %clean section - remove %defattr lines - add a joker for libqrencode.so.* files- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Rebuild for new libpng- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Fixed the rpath problem.- Fixed some small spec mistakes.- Fixed some small errors.- Initial build./sbin/ldconfig/sbin/ldconfig3.4.1-3.el73.4.1-3.el7libqrencode.so.3libqrencode.so.3.4.1qrencode-libs-3.4.1COPYINGChangeLogNEWSREADMETODO/usr/lib64//usr/share/doc//usr/share/doc/qrencode-libs-3.4.1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0x8b660386bad0243d25c75c220206c01ff6f12b5e, strippeddirectoryPascal source, ASCII textASCII textC source, ASCII textPRRRRR ?`@S1%$ƨwYbZI8;[K)Q=F'9< wddfϺ9AxzXn? ?_]Bdi RuTly{cCK'h!d0ށ'WY#0+G;wL(0تa= mUo&΅w8(MWcj;ڰ+)mNJA%VQ9(q!cjd~;R53bmeOJ\xܳOԞ7B/539r= gPTHT {Rλ|KckbXKA," ؄QMȟ 6̃Lv>_71_نG+bf 5 /<xȀ6͚LqW׊X $oHvS&})<'H ]AnUJ)q{_l|pЉLJƚ^6qr *Cn@#9I$Ev#2d ѬknwQS1%$ƨFcaW+2,tK;^xR8(LB{HoF*=9\M+T{{"dD20{Nsc͉n'! t%k̟j *̤u]=M7@TYdQMY.gb>ḛ̑*7UX,&49M_ȋ$Dp"])#Vy}mJ\ ԟg%d  ai%2FM8c $\MkMxaPnlT?TY~Q~#p" }{N 2V *~vX'Xf]Q)Ev^h%H;(7kv ?$ο'6vI̦\?Ǵ)B,*Ne\ 7+ůQ{ ASyz`Utݽ`Q#ws"uYSGEFX'x`9+]3d6aff51c76103995b5c4533d4b03539b89b8a7ab]Xb1) vegam_mec.bindat vegam_me.bin)d`n vegam_ce.binod_rvega20_vce.binbxtd^ovega20_uvd.bined]tvega20_sos.bint)ad\ vega20_smc.binso(d[Qvega20_sdma1.binodZivega20_sdma.binldY.vega20_rlc.binadXtvega20_pfp.binit)dWvega20_mec2.bin1.dVtvega20_mec.binldU vega20_me.bindT, vega20_ce.bindSuvega20_asd.bindR vega12_vce.binmpodQvega12_uvd.bin.madPvega12_sos.bin.madOvega12_smc.bin dNwvega12_sdma1.bin dMuvega12_sdma.bin dLwvega12_rlc.bin dKwvega12_pfp.bindJmvega12_mec2.binxdIvega12_mec.binxfrdH vega12_me.bindGvega12_gpu_info.binv4dF vega12_ce.bindEvega12_asd.binxf8dDvega10_vce.binxf8dCvega10_uvd.binxf8dBvega10_sos.binvt5dAvega10_smc.bin0d@vega10_sdma1.bind?xvega10_sdma.bind>ovega10_rlc.binermxNXoW(J`Bc$RBcAcCcfix #73190: memcpy negative parameter _bc_new_num_ex - fix #73150: missing NULL check in dom_document_save_html - fix #73284: heap overflow in php_ereg_replace function - fix #73073: CachingIterator null dereference when convert to string - fix #73218: add mitigation for ICU int overflow - fix #73208: integer overflow in imap_8bit caused heap corruption - fix #73082: string length overflow in mb_encode_* function - fix #73174: heap overflow in php_pcre_replace_impl - fix #73275: crash in openssl_encrypt function - fix #73293: NULL pointer dereference in SimpleXMLElement::asXML - fix #73240: Write out of bounds at number_format - fix #73017: memory corruption in wordwrap function- fix #72910: Out of bounds heap read in mbc_to_code() - fix #72926: Uninitialized Thumbail Data Leads To Memory Leakage in exif_process_IFD_in_TIFF - fix #72928: Out of bound when verify signature of zip phar CVE-2016-7414 - fix #73007: add locale length check CVE-2016-7416 - fix #72860: wddx_deserialize use-after-free CVE-2016-7413 - fix #73029: Missing type check when unserializing SplArray CVE-2016-7417 - fix #73052: Memory Corruption in During Deserialized-object Destruction CVE-2016-7411 - fix #73035: Out of bound when verify signature of tar phar - fix #73065: Out-Of-Bounds Read in php_wddx_push_element of wddx.c CVE-2016-7418- fix #72716: initialize buffer before read (ftp) - fix #72663: destroy broken object when unserializing CVE-2016-7124 - fix #72681: consume data even if we're not storing them CVE-2016-7125 - fix #72708: php_snmp_parse_oid integer overflow in memory allocation - fix #72749: wddx_deserialize allows illegal memory access CVE-2016-7129 - fix #70436: Use After Free Vulnerability in unserialize() CVE-2016-7129 - fix #72771: ftps:// opendir wrapper is vulnerable to protocol downgrade attack - fix #72750: wddx_deserialize null dereference CVE-2016-7130 - fix #72627: Memory Leakage In exif_process_IFD_in_TIFF CVE-2016-7128 - fix #72697: select_colors write out-of-bounds CVE-2016-7126 - fix #72730: imagegammacorrect allows arbitrary write access CVE-2016-7127 - fix #72790: wddx_deserialize null dereference with invalid xml CVE-2016-7131 - fix #72799: wddx_deserialize null dereference in php_wddx_pop_element CVE-2016-7132 - fix #72807: do not produce strings with negative length - fix #72836: integer overflow in base64_decode caused heap corruption - fix #72837: integer overflow in bzdecompress caused heap corruption - fix #72838: Integer overflow lead to heap corruption in sql_regcase - fix #72848: integer overflow in quoted_printable_encode caused heap corruption - fix #72849: integer overflow in urlencode - fix #72850: integer overflow in uuencode- fix #72735 regression in exif maker note parser- Update to 5.5.38 - http://www.php.net/releases/5_5_38.php- own tests/doc directories for pecl packages (f24)- Update to 5.5.37 http://www.php.net/releases/5_5_37.php- Update to 5.5.36 http://www.php.net/releases/5_5_36.php- Update to 5.5.35 http://www.php.net/releases/5_5_35.php- Update to 5.5.34 http://www.php.net/releases/5_5_34.php- adapt for F24: define %pecl_xmldir and own it- Update to 5.5.33 http://www.php.net/releases/5_5_33.php- Update to 5.5.32 http://www.php.net/releases/5_5_32.php- Update to 5.5.31 http://www.php.net/releases/5_5_31.php - curl: add CURL_SSLVERSION_TLSv1_x constants- Update to 5.5.30 http://www.php.net/releases/5_5_30.php- Update to 5.5.29 http://www.php.net/releases/5_5_29.php- Update to 5.5.28 http://www.php.net/releases/5_5_28.php- Update to 5.5.27 http://www.php.net/releases/5_5_27.php- update to 5.5.27RC1 - the phar link is now correctly created- Update to 5.5.26 http://www.php.net/releases/5_5_26.php- update to 5.5.26RC1 - opcache is now 7.0.6-dev- Update to 5.5.25 http://www.php.net/releases/5_5_25.php- update to 5.5.25RC1- test build (new zic)- Update to 5.5.24 http://www.php.net/releases/5_5_24.php- update to 5.5.24RC1- Update to 5.5.23 http://www.php.net/releases/5_5_23.php- uxH>Xp.XhpX $Z B?$d' - N0 \r  @   4d   (89 D: GHI\XpYx\]^bdefltuvH whxy  48P ` xghCperl-Business-ISBN-Data20120719.0012.el7The data pack for Business::ISBNThis is a data pack for Business::ISBN. You can update the ISBN data without changing the version of Business::ISBN. Most of the interesting stuff is in Business::ISBN.SB^worker1.bsys.centos.orgCentOSGPL+ or ArtisticCentOS BuildSystem Development/Librarieshttp://search.cpan.org/dist/Business-ISBN-Data/linuxnoarch EE3 h^&A큤A큤A큤AA큤SB^PLPLPLSB]PLPLPLPLPLPLPLSB]SB]SB]PLPLSB]4d2cfc77d0c950938ab6b592395a6be85aece33971101658ab73e957cd1405c5207a67f693f595a04b354f476360d88a98b1c59ad69e63d44477c0ec13c42235932468ecddc18d5b4451155fad7448f45ba5dde7c3a7a1f94f7d9928ab6e0e6dd81ea75a67ba908e2b532c2aaf8daf6849ce8e8c951e5c444e96491c00f518e2ba84e0c07233a812ade951c81307c6b472b513505b6b5953b7bfdea23c6b32adffba0fc879439c253868d7c93dbfca0ecd99bb0e7430b3ecde2d5c83f37e6f13b0db96e65e2b5300f140170b054f3b6c4bb171240b085f4d5e21f16f961bcac99bdde94940c4ca3357c3fcf5d94c806c76190b5063eb0f6fb4eff94170768235e7cd40b0f5cb02a0a8ecd67657170df8787a9d3939b2653c722728bada6a31297f7a285ca9a7ce64b994c7b5d7b7f881b7a9841a87f4c95a232b1696531cdc30b0c02ab7bcbc425667e101f938c4c4ea77c74858e7252b9a310f7e24b35b43393e974be329a28f5267bbc5522cf1433699bbce4118534ce518e3f475771e421cc82fac231cf5301e39c8b9bef0e1a124d33111d4775345853191029947b309c6rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-Business-ISBN-Data-20120719.001-2.el7.src.rpmperl(Business::ISBN::Data)perl-Business-ISBN-Data@@ @@@@@@    /usr/bin/perlperlperl(:MODULE_COMPAT_5.16.3)perl(Carp)perl(File::Basename)perl(File::Spec::Functions)perl(strict)perl(vars)perl(warnings)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)1:5.0103.0.4-14.6.0-14.0-15.2-14.11.1RkP1@P@P H@O؀OW@ONMQ0@MKtK@JJjI@I*@GG<4G @G @Daniel Mach - 20120719.001-2Paul Howarth - 20120719.001-1Paul Howarth - 20120719-1Fedora Release Engineering - 20081208-10Petr Pisar - 20081208-9Paul Howarth - 20081208-8Fedora Release Engineering - 20081208-7Marcela Mašláňová - 20081208-6Fedora Release Engineering - 20081208-5Marcela Maslanova - 20081208-4Marcela Maslanova - 20081208-3Stepan Kasal <x-XqUOZ$JZ[YhpRemote.xmlTest.phpTest.xmlCommon.phpConfig.phpDependency2.phpDependencyDB.phpDownloaderDownloader.phpPackage.phpErrorStack.phpException.phpFrontendFrontend.phpCLI.phpInstallerInstaller.phpRoleRole.phpCfg.phpCfg.xmlCommon.phpData.phpData.xmlDoc.phpDoc.xmlExt.phpExt.xmlMan.phpMan.xmlPhp.phpPhp.xmlScript.phpScript.xmlSrc.phpSrc.xmlTest.phpTest.xmlWww.phpWww.xmlPackageFilePackageFile.phpGeneratorv1.phpv2.phpParserv1.phpv2.phpv1.phpv2v2.phpValidator.phprw.phpPackager.phpProxy.phpRESTREST.php10.php11.php13.phpRegistry.phpRunTest.phpTaskCommon.phpPostinstallscriptPostinstallscript.phprw.phpReplaceReplace.phprw.phpUnixeolUnixeol.phprw.phpWindowseolWindowseol.phprw.phpValidate.phpValidatorPECL.phpXMLParser.phpStructuresGraphGraph.phpManipulatorAcyclicTest.phpTopologicalSorter.phpNode.phpSystem.phpXMLUtil.phppearcmd.phppeclcmd.phptestspearConsole_Getopttests001-getopt.phptbug10557.phptbug11068.phptbug13140.phptStructures_GraphtestsAcyclicTestTest.phpBasicGraphTest.phpTopologicalSorterTest.phphelper.incXML_UtiltestsAbstractUnitTests.phpApiVersionTests.phpAttributesToStringTests.phpBug18343Tests.phpBug21177Tests.phpBug21184Tests.phpBug4950Tests.phpBug5392Tests.phpCollapseEmptyTagsTests.phpCreateCDataSectionTests.phpCreateCommentTests.phpCreateEndElementTests.phpCreateStartElementTests.phpCreateTagFromArrayTests.phpCreateTagTests.phpGetDocTypeDeclarationTests.phpGetXmlDeclarationTests.phpIsValidNameTests.phpRaiseErrorTests.phpReplaceEntitiesTests.phpReverseEntitiesTests.phpSplitQualifiedNameTests.phppeclphp-pearpear.channels.aliaspear.txtpecl.txtphpdocs.txt__uri.regdoc.php.net.regpear.php.net.regpecl.php.net.reg.depdb.depdblock.filemap.lock.registry.channel.__uri.channel.doc.php.net.channel.pecl.php.netarchive_tar.regconsole_getopt.regpear.regpear_manpages.regstructures_graph.regxml_util.regpkgxmlArchive_Tar.xmlConsole_Getopt.xmlPEAR.xmlPEAR_Manpages.xmlStructures_Graph.xmlXML_Util.xmlwwwhtmlphp56-pearmacros.php56-pear/opt/remi/php56/root/etc//opt/remi/php56/root/usr/bin//opt/remi/php56/root/usr/share/doc//opt/remi/php56/root/usr/share/doc/pear//opt/remi/php56/root/usr/share/doc/pear/Archive_Tar//opt/remi/php56/root/usr/share/doc/pear/Archive_Tar/docs//opt/remi/php56/root/usr/share/doc/pear/PEAR//opt/remi/php56/root/usr/share/doc/pear/Structures_Graph//opt/remi/php56/root/usr/share/doc/pear/Structures_Graph/docs//opt/remi/php56/root/usr/share/doc/pear/Structures_Graph/docs/tutorials//opt/remi/php56/root/usr/share/doc/pear/Structures_Graph/docs/tutorials/Structures_Graph//opt/remi/php56/root/usr/share/doc/pear/XML_Util//opt/remi/php56/root/usr/share/doc/pear/XML_Util/examples//opt/remi/php56/root/usr/share/doc/php56-php-pear-1.10.15//opt/remi/php56/root/usr/share/licenses//opt/remi/php56/root/usr/share/licenses/php56-php-pear-1.10.15//opt/remi/php56/root/usr/share/man/man1//opt/remi/php56/root/usr/share/man/man5//opt/remi/php56/root/usr/share//opt/remi/php56/root/usr/share//opt/remi/php56/root/usr/share/pear-data//opt/remi/php56/root/usr/share/pear-data/PEAR//opt/remi/php56/root/usr/share/pear//opt/remi/php56/root/usr/share/pear/Archive//opt/remi/php56/root/usr/share/pear/Console//opt/remi/php56/root/usr/share/pear/OS//opt/remi/php56/root/usr/share/pear/PEAR//opt/remi/php56/root/usr/share/pear/PEAR/ChannelFile//opt/remi/php56/root/usr/share/pear/PEAR/Command//opt/remi/php56/root/usr/share/pear/PEAR/Downloader//opt/remi/php56/root/usr/share/pear/PEAR/Frontend//opt/remi/php56/root/usr/share/pear/PEAR/Installer//opt/remi/php56/root/usr/share/pear/PEAR/Installer/Role//opt/remi/php56/root/usr/share/pear/PEAR/PackageFile//opt/remi/php56/root/usr/share/pear/PEAR/PackageFile/Generator//opt/remi/php56/root/usr/share/pear/PEAR/PackageFile/Parser//opt/remi/php56/root/usr/share/pear/PEAR/PackageFile/v2//opt/remi/php56/root/usr/share/pear/PEAR/REST//opt/remi/php56/root/usr/share/pear/PEAR/Task//opt/remi/php56/root/usx8XrZ`7i$\iiGS?Nd  & D )/8WW BW W LW W WXW WW H  !v (!8!E9"E:0EB:G:WH;WI=PWX=Y=Z=[=\=W]?LW^D bFdGPeGUfGXlGZtGtWuHWvJ,wJWxKWyM8ENLNPNN6P P6 SSDSHWSgShSCpython2-certbot-apache1.11.01.el7The apache plugin for certbotPlugin for certbot that allows for automatic configuration of apache_buildhw-x86-12.iad2.fedoraproject.org XFedora ProjectFedora ProjectASL 2.0Fedora ProjectUnspecifiedhttps://pypi.python.org/pypi/certbot-apachelinuxnoarchR9PKrG""'hMGNGN__  2|44 x V__#l'A'AgII!iLL  hjjmm7HHP*"AA큤A큤A큤A큤A큤A큤_______________________________________________________________________________________6663bd941763e9767f2710f2d51b8d324e10c62e15f0a4efb1bb7dae6c23ce8baceb9a4849ed8d01237e7388c837c56e7292884064b52980bedff75d1d1c583701ba4719c80b6fe911b091a7c05124b64eeece964e09c058ef8f9805daca546bfbd69d4ba7599efa5c057740ae6e67f5dcc1dc866b99587a4bc525b4e7bbff4ff29e709d3590a0f58b57432eb425087ed4e3bd08ace60d5acc42338e3ee2797b06c11034fe6dedd98249c3b5a6e9d87613f9eb67075b191803de331baabe74d088f32bed6015aa4802268a9f1a29f847c8b9c3d53859621ae1d859215ba4180c130a2a8505c83e22fd682b3101debc3982339cc2e0a6993d43e545cd7a8cb487130a2a8505c83e22fd682b3101debc3982339cc2e0a6993d43e545cd7a8cb48788f32bed6015aa4802268a9f1a29f847c8b9c3d53859621ae1d859215ba4180c9153dfa3faa2467c151b13611ca8dc31e4158aee4c11d507604d8b5edca2c42a9153dfa3faa2467c151b13611ca8dc31e4158aee4c11d507604d8b5edca2c42a550cf6d32f0bd0c58d709e6649cc8e8f0d3e186e650865901b0ccaee18a46dd11f5ee671b80413ab6792e86787ca72b46f8bf61fe477c1ba135e57f49831586b1f5ee671b80413ab6792e86787ca72b46f8bf61fe477c1ba135e57f49831586b3d642cfca4d11a337d08d2e09552fdc9e357e0ad32ea461bd079ca3db7178ca57ebe36eb521f490a9bdbd78a4700678a7d1152267df1def00357bff280ce7ed27ebe36eb521f490a9bdbd78a4700678a7d1152267df1def00357bff280ce7ed26632fb618b0f1d428d7215c508fa22981f6f64cbd45a1fe1360bd8bf471b71c16dec23e78c4afb5c82188d752dc38e7098723352012728e756a2844cffc314e39631e46e00840818b340877a4887c6eaa53edc095dc61b5d313503c1847132df4ae7a1029b21594632ac15da2a3366afe147db0283b9f4188f7df3e2a86cfe64461ac634b3ad502e04c22ce1c7f41f352234599e8c242a704c41300f31dfd7fb6394b90490170c6bcf13612c4c6c20c0959906b0b15baa5bdb18dfdd4d50d1e56394b9x Xs7W0-gu$wgufuhu - 1.41.0-0.6Benjamin Kosnik - 1.41.0-0.5Denis Arnaud - 1.40.0-1Petr Machata - 1.39.0-11Petr Machata - 1.39.0-10Petr Machata - 1.39.0-9Petr Machata - 1.39.0-8Jitesh Shah 1.39.0-7Karsten Hopp 1.39.0-6Tomas Mraz - 1.39.0-5Fedora Release Engineering - 1.39.0-4Petr Machata - 1.39.0-3Benjamin Kosnik - 1.39.0-2Benjamin Kosnik - 1.39.0-1Benjamin Kosnik - 1.39.0-0.3Petr Machata - 1.39.0-0.2Benjamin Kosnik - 1.39.0-0.1Benjamin Kosnik - 1.37.0-7Petr Machata - 1.37.0-6Fedora Release Engineering - 1.37.0-4Petr Machata - 1.37.0-3Petr Machata - 1.37.0-2Benjamin Kosnik - 1.37.0-1Benjamin Kosnik - 1.37.0-0.1Benjamin Kosnik - 1.36.0-1Petr Machata - 1.34.1-17Petr Machata - 1.36.0-0.1.beta1Petr Machata - 1.34.1-16Tom "spot" Callaway - 1.34.1-15Petr Machata - 1.34.1-14Petr Machata - 1.34.1-13Petr Machata - 1.34.1-12Petr Machata - 1.34.1-11Petr Machata - 1.34.1-10Benjamin Kosnik 1.34.1-7Benjamin Kosnik 1.34.1-5Benjamin Kosnik 1.34.1-4Benjamin Kosnik 1.34.1-3Benjamin Kosnik 1.34.1-2Benjamin Kosnik 1.34.1-1Benjamin Kosnik 1.34.1.rc1-0.1Benjamin Kosnik 1.33.1-13Benjamin Kosnik 1.33.1-12Benjamin Kosnik 1.33.1-11Benjamin Kosnik 1.34.0-0.5Benjamin Kosnik 1.33.1-10Benjamin Kosnik 1.33.1-9Benjamin Kosnik 1.33.1-8Benjamin Kosnik 1.33.1-7Jesse Keating - 1.33.1-6.1Karsten Hopp 1.33.1-6Florian La Roche - 1.33.1-5Jesse Keating - 1.33.1-4.2Jesse Keating - 1.33.1-4.1Benjamin Kosnik 1.33.1-4Benjamin Kosnik 1.33.1-3Jesse Keating 1.33.1-2Benjamin Kosnik 1.33.1-1Nils Philippsen 1.33.0-4Benjamin Kosnik 1.33.0-3Benjamin Kosnik 1.33.0-1Benjamin Kosnik 1.32.0-6Benjamin Kosnik 1.32.0-5Benjamin Kosnik 1.32.0-4Benjamin Kosnik 1.32.0-3Benjamin Kosnik 1.32.0-2Benjamin Kosnik 1.32.0-1Than Ngo 1.31.0-9Elliot Lee Warren Togami 1.31.0-7Benjamin Kosnik Warren Togami Benjamin Kosnik Elliot Lee Benjamin Kosnik 1.31.0-2Benjamin Kosnik 1.31.0-1Nalin Dahyabhai 1.30.2-2Benjamin Kosnik 1.30.2-1Elliot Lee Florian La Roche Tim Powers 1.30.0-3- Add patch for scoped_thread (#1676674)- Add patch for date-time bug (#1636817)- Patch Boost.Spirit for ppc64 (#1402516)- Install unpatched gcc.jam (#1305019). - Build libboost_python and libboost_python3 such that they depend on their respective libpython (#1302120). (boost-1.53.0-python-libpython_dep.patch, boost-1.53.0-python-abi_letters.patch) - Fix Boost.Python test suite so that PyImport_AppendInittab is called before PyInitialize, which broke thx(Xt)WP $   eld in ps (#871819) - procps states a bug is hit when receiving a signal (#871824) - allow core file generation by ps command (#871825)- Update to 3.3.4- SELinux spelling fixes (#859900)- Tests enabled- Update to 3.3.3-20120807git- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Second usrmove hack - providing /bin/ps- Fixing requires in the devel subpackage (missing (x86-64) macro) - License statement clarification (upstream patch referrenced in the spec header)- Initial version/sbin/ldconfig/sbin/ldconfigprocps  !"#$%&'()*+,-./013.3.10-28.el73.3.10-28.el73.3.10-28.el73.2.9-1freepgreppkillpmappspwdxskillslabtopsnicetloadtopuptimevmstatwwatchlibprocps.so.4libprocps.so.4.0.0sysctlprocps-ng-3.3.10AUTHORSBUGSCOPYINGCOPYING.LIBFAQNEWSREADMEREADME.topTODOfree.1.gzpgrep.1.gzpkill.1.gzpmap.1.gzps.1.gzpwdx.1.gzskill.1.gzslabtop.1.gzsnice.1.gztload.1.gztop.1.gzuptime.1.gzw.1.gzwatch.1.gzsysctl.conf.5.gzsysctl.8.gzvmstat.8.gz/usr/bin//usr/lib64//usr/sbin//usr/share/doc//usr/share/doc/procps-ng-3.3.10//usr/share/man/man1//usr/share/man/man5//usr/share/man/man8/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnu ELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=900174916b6134eec97a615810637055c159df77, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=11813ce2269f322929772c3a31d1e9f3dc53ce13, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=3f037312bd21b58e64c1cef4afce2388ef2d5bc5, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=36fb21d67d92790800dc4212bd9f610602e3dc08, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=4dcbd2e0ffda3bf4ebcb7dddd6e81cbc68fdf82f, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=3a15569e21551a969cb1ed4cba0463ca06bb1ccb, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=ea048ec029e31222948b062a1f7081f58d5abc65, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=7d78f366c2eae4acfc5a8407bc75f1cd6ae01790, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=f067e2a0ca2c4b7ffcea817da3455b9e8a61570a, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=b2467a36c2d7937x0X ``Э$ ! zni]XLG;6*%{oj^YMH<7+&  | p k _ Z N I = 8 , '    } q l ` [ O J > 9 - (    ~ r m a \ P K ? : . )     s n b ] Q L @ ; / *    t o c ^ R M A < 0 +    upd_SNB=1,  vqe`TOC>2-! wrfaUPD?3." xsgbVQE@4/# ythcWRFA50$zuidXSGB61% t    M  T  a($kva0&jYIhlHTa[j"['"H`aԗi$XGhEG+i2It#6hi qI;%7i86T^p > ~@b |V50 Y372(#1!0e0 /.-{8I*lD)h7(|H'##&ҀP%e$ʐK"'t!,8 WL6,|'^o}Bd kP ށ ' }8 Cx *9#~؎?djYxXvV0N$uR- add ldconfig post/postun for -embedded (Hans de Goede)- add php-embedded sub-package- fix build with new glibc - fix License- define php_extdir in macros.php- obsolete php-dbase- add mcrypt, mhash, tidy, mssql subpackages (Dmitry Butskoy) - enable dbase extension and package in -common- update to 5.2.3 (thanks to Jeff Sheltren)- fix php-pdo *_arg_force_ref global symbol abuse (#216125)- rebuild against uw-imap-devel- update to 5.2.2 - synch changes from upstream recommended php.ini- enable SASL support in LDAP extension (#205772)- drop mime_magic extension (deprecated by php-pecl-Fileinfo)- fix regression in str_{i,}replace (from upstream)- update to 5.2.1 - add Requires(pre) for httpd - trim %changelog to versions >= 5.0.0- bump default memory_limit to 32M (#220821) - mark config files noreplace again (#174251) - drop trailing dots from Summary fields - use standard BuildRoot - drop libtool15 patch (#226294)- add php(api), php(zend-abi) provides (#221302) - package /usr/share/php and append to default include_path (#225434)- fix filter.h installation path - fix php-zend-abi version (Remi Collet, #212804)- rebuild again- rebuild for net-snmp soname bump- build json and zip shared, in -common (Remi Collet, #215966) - obsolete php-json and php-pecl-zip - build readline extension into /usr/bin/php* (#210585) - change module subpackages to require php-common not php (#177821)- provide php-zend-abi (#212804) - add /etc/rpm/macros.php exporting interface versions - synch with upstream recommended php.ini- update to 5.2.0 (#213837) - php-xml provides php-domxml (#215656) - fix php-pdo-abi provide (#214281)- rebuild for curl soname bump - add build fix for curl 7.16 API- from upstream: add safety checks against integer overflow in _ecalloc- update to 5.1.6 (security fixes) - bump default memory_limit to 16M (#196802)- rebuild- Provide php-posix (#194583) - only provide php-pcntl from -cli subpackage - add missing defattr's (thanks to Matthias Saou)- move Obsoletes for php-openssl to -common (#194501) - Provide: php-cgi from -cli subpackage- split out php-cli, php-common subpackages (#177821) - add php-pdo-abi version export (#193202)- rebuilt for new libnetsnmp- provide mod_php (#187891) - provide php-cli (#192196) - use correct LDAP fix (#181518) - define _GNU_SOURCE in php_config.h and leave it defined - drop (circular) dependency on php-pear- update to 5.1.4- update to 5.1.3- provide php-api (#183227) - add provides for all builtin modules (Tim Jackson, #173804) - own %{_libdir}/php/pear for PEAR packages (per #176733) - add obsoletes to allow upgrade from FE4 PDO packages (#181863)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild for new libc-client soname- only build xmlreader and xmlwriter shared (#177810)- update to 5.1.2- rebuild again- rebuild for new net-snmp- enable short_open_tag in default php.ini again (#175381)- rebuilt- require net-snmp for php-snmp (#174800)- add /usr/share/pear back to hard-coded include_path (#174885)- rebuild for httpd 2.2- update to 5.1.1 - remove pear subpackage - enable pdo extensions (php-pdo subpackage) - remove non-standard conditional module builds - enable xmlreader extension- rebuilt against new openssl- pear: update to XML_RPC 1.4.4, XML_Parser 1.2.7, Mail 1.1.9 (#172528)- rebuild for new libnetsnmp- update to 5.0.5 - add fix for upstream #34435 - devel: require autoconf, automake (#159283) - pear: update to HTTP-1.3.6, Mail-1.1.8, Net_SMTP-1.2.7, XML_RPC-1.4.1 - fix imagettftext et al (upstream, #161001)- ldap: restore ldap_start_tls() function- disable RPATHs in shared extensions (#156974)- build simplexml_import_dom even with shared dom (#156434) - prevent truncation of copied files to ~2Mb (#155916) - install /usr/bin/php from CLI build alongside CGI - enable sysvmsg extension (#142988)- prevent build of builtin dba as well as shared extension- split out dba and bcmath extensions into subpackages - BuildRequire gcc-c++ to avoid AC_PROG_CXX{,CxXwW0$Ń$UŃƃărton 5.2.0-9Joe Orton 5.2.0-8Joe Orton 5.2.0-7Joe Orton 5.2.0-6Joe Orton 5.2.0-5Joe Orton 5.2.0-4Joe Orton 5.2.0-3Joseph Orton 5.1.6-4Joe Orton 5.1.6-3Joe Orton 5.1.6-2Jesse Keating - 5.1.4-8.1Joe Orton 5.1.4-8Joe Orton 5.1.4-7Joe Orton 5.1.4-6Radek Vokal 5.1.4-5.1Joe Orton 5.1.4-5Joe Orton 5.1.4-3Joe Orton 5.1.3-3Joe Orton 5.1.2-5Jesse Keating - 5.1.2-4.3Jesse Keating - 5.1.2-4.1Joe Orton 5.1.2-4Joe Orton 5.1.2-3Joe Orton 5.1.2-2Joe Orton 5.1.1-8Joe Orton 5.1.1-7Joe Orton 5.1.1-6Jesse Keating Joe Orton 5.1.1-5Joe Orton 5.1.1-4Joe Orton 5.1.1-3Joe Orton 5.1.1-2Tomas Mraz 5.0.5-6Joe Orton 5.0.5-5Joe Orton 5.0.5-4Joe Orton 5.0.5-3Joe Orton 5.0.4-11Joe Orton 5.0.4-10Joe Orton 5.0.4-9Joe Orton 5.0.4-8Joe Orton 5.0.4-7Joe Orton 5.0.4-6Joe Orton 5.0.4-5Joe Orton 5.0.4-4Joe Orton 5.0.4-3Joe Orton 5.0.4-2Joe Orton 5.0.4-1Joe Orton 5.0.3-5Joe Orton 5.0.3-4Joe Orton 5.0.3-3Joe Orton 5.0.3-2Joe Orton 5.0.3-1Joe Orton 5.0.2-8Joe Orton 5.0.2-7Joe Orton 5.0.2-6Joe Orton 5.0.2-5Joe Orton 5.0.2-4Joe Orton 5.0.1-4Joe Orton 5.0.1-3Joe Orton 5.0.1-2Joe Orton 5.0.1-1Tom Callaway Tom Callaway - Fix filter bypass in filter_var FILTER_VALIDATE_URL CVE-2024-5458- Fix __Host-/__Secure- cookie bypass due to partial CVE-2022-31629 fix CVE-2024-2756 - Fix password_verify can erroneously return true opening ATO risk CVE-2024-3096- use oracle client library version 21.13 on x86_64 - patch test suite for zlib-ng - add EOL message- use ICU 73.2 - use oracle client library version 21.12 on x86_64, 19.19 on aarch64 - add fixes for libxml 2.11 and 2.12 from 8.1- use oracle client library version 21.11 on x86_64, 19.19 on aarch64 - use official Oracle Instant Client RPM- Update to 8.0.30 - http://www.php.net/releases/8_0_30.php - move httpd/nginx wants directive to config files in /etc- Update to 8.0.29 - http://www.php.net/releases/8_0_29.php- define %php80___phpize and %php80___phpconfig- use ICU 72.1 - use oracle client library version 21.10 - fix missing TZData version in intl phpinfo - fix possible buffer overflow in date- F38: enable imap extension- Update to 8.0.28 - http://www.php.net/releases/8_0_28.php - add dependency on pcre2 minimal version- Update to 8.0.27 - http://www.php.net/releases/8_0_27.php - use oracle client library version 21.8- Update to 8.0.26 - http://www.php.net/releases/8_0_26.php- update to 8.0.26RC1- Update to 8.0.25 - http://www.php.net/releases/8_0_25.php- update to 8.0.25RC1- Update to 8.0.24 - http://www.php.net/releases/8_0_24.php- update to 8.0.24RC1- Update to 8.0.23 - http://www.php.net/releases/8_0_23.php- update to 8.0.23RC1 - use oracle client library version 21.7 - use ICU 71.1- Update to 8.0.22 - http://www.php.net/releases/8_0_22.php- fix snmp backport- xXxX$k relocated- clarify Licenses - missing provides xmlreader and xmlwriter - change php embedded library soname version to 5.4- fix mysql_sock macro definition- fix standard build (non scl)- fix installed headers- use libldap_r for ldap extension- add missing scl_prefix in some provides/requires- make php-enchant optionnal, not available on RHEL-5 - make php-recode optionnal, not available on RHEL-5 - disable t1lib on RHEL-5- enable tidy on RHEL-6 only - re-enable unit tests- minor macro fixes for RHEL-5 build - update autotools workaround for RHEL-5 - use readline when libedit not available (RHEL-5)- update to 5.4.8 - define both session.save_handler and session.save_path - fix possible segfault in libxml (#828526) - use SKIP_ONLINE_TEST during make test - php-devel requires pcre-devel and php-cli (instead of php) - provides php-phar - update systzdata patch to v10, timezone are case insensitive- php-fpm: create apache user if needed - php-cli: provides cli command in standard root (scl)- add configtest option to init script - test configuration before service reload - fix php-fpm service relocation - fix php-fpm config relocation - drop embdded subpackage for scl- missing requires on scl-runtime - relocate /var/lib/session - fix php-devel requires - rename, but don't relocate macros.php- initial spec rewrite for scl build- fix typo in systemd macro- php-fpm: enable PrivateTmp - php-fpm: new systemd macros (#850268) - php-fpm: add upstream patch for startup issue (#846858)- systemd integration, https://bugs.php.net/63085 - no odbc call during timeout, https://bugs.php.net/63171 - check sqlite3_column_table_name, https://bugs.php.net/63149- most failed tests explained (i386, x86_64)- fix for http://bugs.php.net/63126 (#783967)- patch to ensure we use latest libdb (not libdb4)- really fix rhel tests (use libzip and libdb)- fix test to enable zip extension on RHEL-7- remove session.save_path from php.ini move it to apache and php-fpm configuration files- update to 5.4.7 http://www.php.net/releases/5_4_7.php - php-fpm: don't daemonize- enable php-fpm on secondary arch (#849490)- update to 5.4.6 - update to v9 of systzdata patch - backport fix for new libxml- update to 5.4.5- also provide php(language)%{_isa} - define %{php_version}- drop BR for libevent (#835671) - provide php(language) to allow version check- add missing provides (core, ereg, filter, standard)- update to 5.4.4 (CVE-2012-2143, CVE-2012-2386) - use /usr/lib/tmpfiles.d instead of /etc/tmpfiles.d - use /run/php-fpm instead of /var/run/php-fpm- update to 5.4.3 (CVE-2012-2311, CVE-2012-2329)- update to 5.4.2 (CVE-2012-1823)- update to 5.4.1- rebuild for new icu - switch (conditionally) to libdb-devel- fix Loadmodule with MPM event (use ZTS if not MPM worker) - split conf.d/php.conf + conf.modules.d/10-php.conf with httpd 2.4- rebuild for missing automatic provides (#807889)- really use _httpd_mmn- rebuild against httpd 2.4 - use _httpd_mmn, _httpd_apxs macros- update to PHP 5.4.0 finale- update to PHP 5.4.0RC8- update to PHP 5.4.0RC7 - provides env file for php-fpm (#784770) - add patch to use system libzip (thanks to spot) - don't provide INSTALL file- all binaries in /usr/bin with zts prefix- update to PHP 5.4.0RC6 https://fedoraproject.org/wiki/Features/Php54- fix systemd unit- switch to systemd- Rebuild for new libpng- rebuild with new gmp without compat lib- rebuild with new gmp- revert is_a() to php <= 5.3.6 behavior (from upstream) with new option (allow_string) for new behavior- add mysqlnd sub-package - drop patch4, use --libdir to use /usr/lib*/php/build - add patch to redirect mysql.sock (in mysqlnd)- update to 5.3.8 http://www.php.net/ChangeLog-5.php#5.3.8- update to 5.3.7 http://www.php.net/ChangeLog-5.php#5.3.7 - merge php-zts into php (#698084)- rebuild for net-snmp SONAME bump- enable mhash extension (emulated by hash extension)- rebuild for new MySQL client library- update to 5.3.6 http://www.php.net/ChangeLog-5.php#5.3.6 - fix php-pdo arch specific reqxXyCU&$6&'%- php-config: reports all built sapis- rebuild as retagged- Update to 7.0.0RC5 - update php-fpm.d/www.conf comments - API and Zend API are now set to 20151012- Update to 7.0.0RC4 - php-fpm: set http authorization headers- F23 rebuild with rh_layout- Update to 7.0.0RC3 - disable zip extension (provided in php-pecl-zip)- Update to 7.0.0RC2 - enable oci8 and pdo_oci extensions - sync php.ini with upstream php.ini-production- Update to 7.0.0RC1- Update to 7.0.0beta3- Update to 7.0.0beta2 - switch from libvpx to libwebp (only for bundled libgd, not used)- Update to 7.0.0beta1 - use upstream tarball instead of git snapshot- Update to 7.0.0alpha2 - use new layout (/etc/opt, /var/opt)- new snapshot- new snapshot - the phar link is now correctly created- Update to 7.0.0alpha1- new snapshot- new snapshot - t1lib support have been removed- new snapshot- new snapshot- new snapshot- add experimental file based opcode cache (disabled by default)- new snapshot- new snapshot - adapt system tzdata patch for upstream change for new zic- new snapshot- new snapshot- new snapshot- rename 10-php70-php.conf to 15-php70-php.conf to ensure load order (after 10-rh-php56-php.conf)- rebuild- fix mod_php configuration - disable static json - sync php.ini with upstream php.ini-production- update for php 7.0.0 - ereg, mssql, mysql and sybase_ct extensions are removed - add pdo-dblib subpackage (instead of php-mssql) - disable oci8 extension, not yet adapted for 7.0 - add php-zip subpackage - add php-json subpackage- Update to 5.6.7 http://www.php.net/releases/5_6_7.php- update to 5.6.7RC1- Update to 5.6.6 http://www.php.net/releases/5_6_6.php- Update to 5.6.5 http://www.php.net/releases/5_6_5.php- fix php-fpm.service.d location- update to 5.6.5RC1 - add base system path in default include path - FPM: enable ACL for Unix Domain Socket- Update to 5.6.4 http://www.php.net/releases/5_6_4.php - add sybase_ct extension (in mssql sub-package) - xmlrpc requires xml- Update to 5.6.4 http://www.php.net/releases/5_6_4.php- update to 5.6.4RC1- add embedded sub package - filter all libraries to avoid provides- FPM: add upstream patch for https://bugs.php.net/68421 access.format=R doesn't log ipv6 address - FPM: add upstream patch for https://bugs.php.net/68420 listen=9000 listens to ipv6 localhost instead of all addresses - FPM: add upstream patch for https://bugs.php.net/68423 will no longer load all pools- Update to PHP 5.6.3 http://php.net/releases/5_6_3.php- update to 5.6.3RC1 - new version of systzdata patch, fix case sensitivity - ignore Factory in date tests - disable opcache.fast_shutdown in default config - add php56-cgi command in base system- Update to PHP 5.6.2 http://php.net/releases/5_6_2.php- Update to PHP 5.6.1 http://php.net/releases/5_6_1.php - use default system cipher list by Fedora policy http://fedoraproject.org/wiki/Changes/CryptoPolicy - add system php library to default include_path- enable libvpx on EL 6 (with libvpx 1.3.0) - add php56-phpdbg command in base system- PHP 5.6.0 is GA - add lsphp56 command in base system- initial spec for PHP 5.6 as Software Collection - adapted from php 5.6 spec file from remi repository - adapted from php 5.5 spec file from rhscl 1.1- fileinfo: fix out-of-bounds memory access CVE-2014-2270 - fileinfo: fix extensive backtracking CVE-2013-7345- gd: fix NULL deref in imagecrop CVE-2013-7327 - gd: drop vpx support, fix huge memory consumption #1075201- fix patch name - fix memory leak introduce in patch for CVE-2014-1943 - fix heap-based buffer over-read in DateInterval CVE-2013-6712- fix infinite recursion in fileinfo CVE-2014-1943- fix heap overflow vulnerability in imagecrop CVE-2013-7226- allow multiple paths in ini_scan_dir #1058161- add security fix for CVE-2013-6420- rebuild with test enabled - add dependency on php-pecl-jsonc- update to PHP 5.5.6 - buildstrap build- update to PHP 5.5.5 - mod_php only for httpd24- update to PHP 5.5.4 - improve security, use specific soap.wsdl_cache_dir use /vaxXzW/$ddoraproject.org> 5.5.0-0.8.201212110630Remi Collet 5.5.0-0.7.201212110630Remi Collet 5.5.0-0.6.201212110630Remi Collet 5.5.0-0.6.201212100830Remi Collet 5.5.0-0.5.201212100830Remi Collet 5.5.0-0.4.201211301534Remi Collet 5.5.0-0.3.201211301534Remi Collet 5.5.0-0.2.201211301534Remi Collet 5.5.0-0.1.201211300857Remi Collet 5.4.9-2Remi Collet 5.4.9-1Remi Collet 5.4.9-0.5.RC1Remi Collet 5.4.9-0.4.RC1Remi Collet 5.4.9-0.3.RC1Remi Collet 5.4.9-0.2.RC1Remi Collet 5.4.9-0.1.RC1Remi Collet 5.4.9-0.2.RC1Remi Collet 5.4.8-6Remi Collet 5.4.9-0.1.RC1Remi Collet 5.4.8-5Remi Collet 5.4.8-4Remi Collet 5.4.8-3Joe Orton - 5.4.8-2Remi Collet 5.4.8-1Remi Collet 5.4.8-0.3.RC1Remi Collet 5.4.8-0.2.RC1Remi Collet 5.4.8-0.1.RC1Remi Collet 5.4.7-10Remi Collet 5.4.7-9Remi Collet 5.4.7-8Remi Collet 5.4.7-7Remi Collet 5.4.7-6Remi Collet 5.4.7-6Remi Collet 5.4.7-5Remi Collet 5.4.7-5Remi Collet 5.4.7-4Remi Collet 5.4.7-3Remi Collet 5.4.7-2Remi Collet 5.4.7-1Remi Collet 5.4.7-1Remi Collet 5.4.7-0.2.RC1Remi Collet 5.4.7-0.1.RC1Remi Collet 5.4.6-2Remi Collet 5.4.6-1Remi Collet 5.4.6-0.1.RC1Remi Collet 5.4.5-1Remi Collet 5.4.5-0.2.RC1Remi Collet 5.4.5-0.1.RC1Remi Collet 5.4.4-4Remi Collet 5.4.4-2Remi Collet 5.4.4-1Remi Collet 5.4.4-0.2.RC2Remi Collet 5.4.4-0.1.RC1Remi Collet 5.4.3-1Remi Collet 5.4.2-1Remi Collet 5.4.1-1Remi Collet 5.4.1-0.3.RC2Remi Collet 5.4.1-0.2.RC1Remi Collet 5.4.1-0.1.RC1Remi Collet 5.4.0-1.1Joe Orton - 5.4.0-2Remi Collet 5.4.0-1Remi Collet 5.4.0-0.16.RC8Remi Collet 5.4.0-0.15.RC7Remi Collet 5.4.0-0.14.RC6Remi Collet 5.4.0-0.13.RC6Remi Collet 5.4.0-0.12.RC6Remi Collet 5.4.0-0.11.RC6Remi Collet 5.4.0-0.10.RC5Remi Collet 5.4.0-0.9.RC5Remi Collet 5.4.0-0.8.RC5Remi Collet 5.4.0-0.7.201201041830Remi Collet 5.4.0-0.6.201112300630Remi Collet 5.4.0-0.6.201112261030Remi Collet 5.4.0-0.5.201112170630Remi Collet 5.4.0-0.4.201112121330Remi Collet 5.4.0-0.3.201112091730Remi Collet 5.4.0-0.3.201111260730Remi Collet 5.4.0-0.3.201111130730Remi Collet 5.4.0-0.2.201109081430Remi Collet 5.4.0-0.1.201109031230xpX{W@shȃ$XȃɃǃollet - 7.2.0-0.2.20170424.eb68c0dRemi Collet - 7.2.0-0.1.20170412.efeab78Remi Collet - 7.1.4-1Remi Collet - 7.1.4-0.1.RC1Remi Collet - 7.1.3-1Remi Collet - 7.1.3-0.2.RC1Remi Collet - 7.1.3-0.1.RC1Remi Collet - 7.1.2-1Remi Collet - 7.1.2-0.2.RC1Remi Collet 7.1.2-0.1.RC1Remi Collet 7.1.1-3Remi Collet 7.1.1-2Remi Collet 7.1.1-1Remi Collet 7.1.1-0.1.RC1Remi Collet 7.1.0-2Remi Collet 7.1.0-1Remi Collet 7.1.0-0.13.RC6Remi Collet 7.1.0-0.12.RC5Remi Collet 7.1.0-0.11.RC4Remi Collet 7.1.0-0.10.RC3Remi Collet 7.1.0-0.9.RC3Remi Collet 7.1.0-0.8.RC2Remi Collet 7.1.0-0.8.RC1Remi Collet 7.1.0-0.7.beta2Remi Collet 7.1.0-0.6.beta1Remi Collet 7.1.0-0.5.alpha3Remi Collet 7.1.0-0.4.alpha2Remi Collet 7.1.0-0.3.alpha2Remi Collet 7.1.0-0.2.alpha2Remi Collet 7.1.0-0.1.alpha1Remi Collet 7.0.7-1Remi Collet 7.0.7-0.1.RC1Remi Collet 7.0.6-3Remi Collet 7.0.6-2Remi Collet 7.0.6-0.2.RC1Remi Collet 7.0.5-2Remi Collet 7.0.5-1Remi Collet 7.0.5-0.1.RC1Remi Collet 7.0.4-2Remi Collet 7.0.4-1Remi Collet 7.0.4-0.1.RC1Remi Collet 7.0.3-1Remi Collet 7.0.3-0.3.20160129gitdd3d10cRemi Collet 7.0.3-0.2.RC1Remi Collet 7.0.3-0.1.RC1Remi Collet 7.0.2-1Remi Collet 7.0.2-0.1.RC1Remi Collet 7.0.1-1Remi Collet 7.0.1-0.1.RC1Remi Collet 7.0.0-2Remi Collet 7.0.0-1Remi Collet 7.0.0-0.26.RC8Remi Collet 7.0.0-0.25.RC8Remi Collet 7.0.0-0.24.RC7Remi Collet 7.0.0-0.23.RC7Remi Collet 7.0.0-0.22.RC6Remi Collet 7.0.0-0.21.RC5Remi Collet 7.0.0-0.20.RC5Remi Collet 7.0.0-0.19.RC5Remi Collet 7.0.0-0.18.RC4Remi Collet 7.0.0-0.17.RC3Remi Collet 7.0.0-0.16.RC3Remi Collet 7.0.0-0.15.RC2Remi Collet 7.0.0-0.14.RC1Remi Collet 7.0.0-0.13.beta3Remi Collet 7.0.0-0.12.beta2Remi Collet 7.0.0-0.11.beta1Remi Collet 7.0.0-0.10.alpha2Remi Collet 7.0.0-0.9.20150617git3697f02Remi Collet 7.0.0-0.9.20150611git8cfe282Remi Collet 7.0.0-0.8.alpha1Remi Collet 7.0.0-0.7.20150602git8a089e7Remi Collet 7.0.0-0.7.20150525git6f46fa3Remi Collet 7.0.0-0.6.20150525git404360fRemi Collet 7.0.0-0.6.20150518gitcee8857Remi Collet 7.0.0-0.6.20150515gitc9f27eeRemi Collet 7.0.0-0.6.20150507gitdd0b602Remi Collet 7.0.0-0.5.2xwX|kWX'u$nuuuon.- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Update to 0.50.0 - Drop patch carried for bz#568845 (schemas-merge) per last comment in that bug.- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Update to 0.41.1- Update to 0.41.0- Convert specfile to UTF-8.- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Don't merge translations back into GConf schemas- Update to 0.40.6- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- turn noarch- Update to 0.40.5- Update to 0.40.4- Require gettext-devel- fix license tag- Update to 0.40.3- Update to 0.40.1- Update to 0.40.0- Update to 0.37.1- Autorebuild for GCC 4.3- Require gettext- Update to 0.37.0- Update to 0.36.3- Update to 0.36.2- Update to 0.36.1- Update to 0.36.0 - Update license field - Drop patch rejected, obsolete and upstreamed patches - Some spec file cleanups - Require automake- Add support for PolicyKit .policy files (b.g.o #462312)- Don't produce useless debuginfo (#249969)- don't store a translation if it is equal to the original string- add upstream changeset 674 (GNOME bz#413461 - fix intltool-extract path)- Update to 0.35.5- Update to 0.35.4- Update to 0.35.2- Add a missing BuildRequires: gettext- rebuild- Update to 0.35.1- Update to a cvs snapshot to allow building gnome 2.15- bump again for double-long bug on ppc(64)- Update to 0.34.2- rebuilt- New upstream version- Rebuild with gcc4- Upgrade to 0.33- fix intltool local mode (upstream 163981)- add BuildRequires on perl-XML-Parser, #132622- bump version- Upgrade to 0.31.1- rebuilt- update to 0.30- rebuilt- new version- update- 0.27- rebuild- 0.26- rebuilt- rebuilt- 0.25- 0.23- automated rebuild- rebuild in different environment- 0.22 - remove perl patch, perl is fixed- tweak the perl5 check to not bomb with perl 5.8- automated rebuild- rebuild in different environment- update to 0.18- update to 0.17- rebuild in new environment- 0.15 - remove dbm patch, dbm no longer used upstream - shorten summary line, #56739- Version 0.14 - Try again on DBM fix - Patch to use AnyDBM_File rather than NDBM_File for caching - Version 0.14- automated rebuild- 0.12.90 cvs snap- 0.12 tarball- new cvs snap, no longer noarch- intltool specfile, based on xml-i18n-tools (but fixed up) - obsolete/provide xml-i18n-tools- Require patch- Fix bug #45699 and #50634 by upgrading version.- s/Copyright/License/ - Shorter summary - Remove empty post/postun scripts - Don't define name and ver on the top and use this in the headers later- cleaned up files list so that there aren't non-standard dirs and so that it owns the xml-i18n-tools dir- Cleaned up spec file a little for Red Hat.- removed devel subpackage- created this thing 0.50.2-7.el7intltool-extractintltool-mergeintltool-prepareintltool-updateintltoolizeintltool.m4intltool-0.50.2AUTHORSCOPYINGREADMEintltoolMakefile.in.inintltool-extract.8.gzintltool-merge.8.gzintltool-prepare.8.gzintltool-update.8.gzintltoolize.8.gz/usr/bin//usr/share/aclocal//usr/share/doc//usr/share/doc/intltool-0.50.2//usr/share//usr/share/intltool//usr/share/man/man8/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnuPerl script, ASCII text executablePOSIX shell script, ASCII text executableM4 macro processor script, ASCII textdirectoryUTF-8 Unicode textASCII textmakefile script, ASCII texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression) x`gX}WXz$.34eb, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=dfc7579ae0ab205a22afb41ba43bf5a9fa12c8b7, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=7c7cb7724303cc16d6b152fddf88eddeeee36dae, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=3071f628ea5e327055527b51ca95c2e7ed4a4895, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=217ebe4aa54b44c43460b082d2754a0acda9c964, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=7b217f7d140306cf280c906cdd0ed75f98093f0e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d411d972cb044ea7f547a11d6215f8973f2c8ae8, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=cd25f6cf0b613f0f39e57d160949a50eb0446dc9, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a16a47cc7df9637994df6c73c4839d80344c4032, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=44a58eb820ca73ce4617f6090912f207705ef4b0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=4c44c03da4e2ec4f3822ea76cb85e3b908fe9ecf, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c7fbee03062bea95836914bba8ef8ccbeb7dff17, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e9b4962cd2e3b15b2dc195684a0b130960eedc63, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8455e02a63645946ac2f4832e02ced9748853fe8, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8cfb5cc653341792cb1907122b57546a65e44489, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=01a8192ab85d5272e40121f3f814c3a0ffcd4b68, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=bbc68c3c31499c1aef36fe57216b2b76dbac0e17, strippedELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=a244b06a1679ecf4e403851914a22aa5d0d60523, strippedBourne-Again shell script, ASCII text executableUTF-8 Unicode texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression) ")07>ELRY`flszPRR RR RR$PRRR RR$PRRR RR RR$PRR RR RR$PRRR RR$PRR RR RR$P RR RR RR$P RR RR RR$P RR RR RR$P RR RR RR$P RR RR RR$PRRR RR$PRR RR RR$PRR RR RR$PRRR RR$PRRR RR$PRR RR RR$PRR RR RR$PRR RR RR$PRRR$PRRRR$PRRRR$PRR RRRR$RR R RR RRRRRRRRRRRR RRRR RRRRR$RR RR R RR RRRRRRRRRRRR RRRR RRRRR$RR? 䠉Z_5$ƨr!tNZcPDrU7s9=V2q7c"uՊIhb92*JVFSBPipA?5g5&JFtik/~hؐFT% hf9An˦"y/6/?G4kϦDxrԿAK}4:X ô+wK>'/o\\_aן !ɅoeT2RKxVX~eVy,$;-2Paul Howarth 2.07-1Marcela Maslanova - 2.06-2Paul Howarth 2.06-1Paul Howarth 2.05-1Stepan Kasal 2.04-4Fedora Release Engineering 2.04-3Fedora Release Engineering 2.04-2Paul Howarth 2.04-1Paul Howarth 2.03-1Tom "spot" Callaway - 2.02-3Tom "spot" Callaway 2.02-2Paul Howarth 2.02-1Paul Howarth 1.77-2Paul Howarth 1.77-1Paul Howarth 1.76-1Paul Howarth 1.74-4Paul Howarth 1.74-3Paul Howarth 1.74-2Ville Skyttä - 1.74-1Ville Skyttä - 1.73-1Ville Skyttä - 1.72-1Ville Skyttä - 1.71-1Ville Skyttä - 1.67-2Paul Howarth - 1.67-1Michael Schwendt - 1.66-2Ville Skyttä - 0:1.66-1Ville Skyttä - 0:1.64-0.fdr.1Ville Skyttä - 0:1.61-0.fdr.2Ville Skyttä - 0:1.61-0.fdr.1Ville Skyttä - 0:1.60-0.fdr.1Dams 0:1.58-0.fdr.5Dams 0:1.58-0.fdr.4Dams 0:1.58-0.fdr.3Dams 0:1.58-0.fdr.2Dams - Mass rebuild 2013-12-27- Add some missing built-time dependencies - Fix a bogus date in changelog - Modernize the spec- Update to 2.12 - Default for Mail::Header::new(Modify) is 'false', not 'true' (CPAN RT#79985) - Mail::Address take username with rindex(), a bit better than index() but still poor (CPAN RT#82056) - Check for bad folding of header lines (CPAN RT#79993) - Add a note about better to avoid Mail::Address->name() (CPAN RT#81459) - Drop UTF8 patch, no longer needed- Update to 2.11 - Fix typo in Mail::Mailer::smtp, which only shows up in Perl > 5.14- Update to 2.10 - Mail::Mailer::smtp set from address twice (CPAN RT#77161) - Mail::Mailer::smtps did not support the From option (CPAN RT#77161) - Mail::Util::mailaddress has now an optional parameter to set the returned value explicitly (CPAN #75975) - BR: perl(base) - Drop BR: perl(Config) and perl(POSIX), not dual-lived - Drop %defattr, redundant since rpm 4.4 - Don't need to remove empty directories from the buildroot- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Perl 5.16 rebuild- Update to 2.09 - Remove dependency to Test::Pod by moving 99pod.t from t/ to xt/ (CPAN RT#69918) - BR: perl(Net::Domain) ≥ 1.05 and perl(Net::SMTP) ≥ 1.03 - Explicitly run xt/ tests- Use DESTDIR rather than PERL_INSTALL_ROOT - One buildreq per line for readability - Add buildreqs for core perl modules, which might be dual-lived- Perl mass rebuild- Update to 2.08 (#709697) - Respect errors on closing a Mail::Mailer::smtp/::smtps connection - Mail::Internet should accept Net::SMTP::SSL as well (CPAN RT#68590) - Document that Mail::Mailer::smtps needs Authen::SASL - Use patch rather than iconv to convert docs to UTF8 encoding - Nobody else likes macros for commands- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Update to 2.07 - Document perl 5.8.1 requirement in README (CPAN RT#61753) - Add "MAIL FROM" to Mail::Mailer::smtp- Mass rebuild with perl-5.12.0- Update to 2.06 (add support for smtps via Net::SMTP::SSL) - Use %{_fixperms} macro instead of our own chmod incantation- Update to 2.05 - Fix de-ref error when index out of range in Mail::Header::get() - Repair fixed selection of smtp for non-unix systems - Do not run pod.t in devel environment - Set default output filename for Mail::Mailer::testfile::PRINT - Warn when no mailers were found (CPAN RT#52901) - Tidy up %xPFX9XN$Get rid of the "warning: Installed (but unpackaged) file(s) found:" Some generated files aren't needed in RPMs: - the "sql-bench/" subdirectory Some files were missing: - /usr/share/aclocal/mysql.m4 ("devel" subpackage) - Manual "mysqlbug" ("server" subpackage) - Program "innochecksum" and its manual ("server" subpackage) - Manual "mysql_find_rows" ("client" subpackage) - Script "mysql_upgrade_shell" ("client" subpackage) - Program "ndb_cpcd" and its manual ("ndb-extra" subpackage) - Manuals "ndb_mgm" + "ndb_restore" ("ndb-tools" subpackage)- Made the "Federated" storage engine an option - Made the "Cluster" storage engine and sub packages an option- Add the man pages for "ndbd" and "ndb_mgmd".- Require a manual upgrade if the alread-installed mysql-server is from another vendor, or is of a different major version.- "ndb_size.tmpl" is not needed any more, "man1/mysql_install_db.1" lacked the trailing '*'.- Removed man page for "mysql_create_system_tables"- Add debug server.- Remove Max RPMs; the server RPMs contain a mysqld compiled with all features that previously only were built into Max.- Add several man pages for NDB which are now created.- Put back "libmygcc.a", found no real reason it was removed. - Add CFLAGS to gcc call with --print-libgcc-file, to make sure the correct "libgcc.a" path is returned for the 32/64 bit architecture.- Fix the move of "mysqlmanager" to section 8: Directory name was wrong.- Include the new man pages for "my_print_defaults" and "mysql_tzinfo_to_sql" in the server RPM. - The "mysqlmanager" man page got moved from section 1 to 8.- Call "make install" using "benchdir_root=%{_datadir}", because that is affecting the regression test suite as well.- Explicitly note that the "MySQL-shared" RPMs (as built by MySQL AB) replace "mysql-shared" (as distributed by SuSE) to allow easy upgrading (bug#22081).- Add "--with-partition" t 2006 Joerg Bruehe - Use the Perl script to run the tests, because it will automatically check whether the server is configured with SSL.- move "mysqldumpslow" from the client RPM to the server RPM (bug#20216) - Revert all previous attempts to call "mysql_upgrade" during RPM upgrade, there are some more aspects which need to be solved before this is possible. For now, just ensure the binary "mysql_upgrade" is delivered and installysql.com> - To run "mysql_upgrade", we need a running server; start it in isolation and skip password checks.- Always compile for PIC, position independent code.- Use character set "all" when compiling with Cluster, to make Cluster nodes independent on the character set directory, and the problem that two RPM sub packages both wants to install this directory.- Use "./libtool --mode=execute" instead of searching for the executable in current directory and ".libs".- Install and run "mysql_upgrade"- Remove sql-bench, and MySQL-bench RPM (will be built as an independent project from the mysql-bench repository)- Remove old mysqltestmanager and related programs- Set $LDFLAGS from $MYSQL_BUILD_LDFLAGS- Changed product name from "Community Edition" to "Community Server"- Fast mutexes is now disabled by default, but should be used in Linux builds.- Reintroduced a max build - Limited testing of 'debug' and 'max' servers - Berkeley DB only in 'max'- Use "-i" on "make test-force"; this is essential for later evaluation of this log file.- Pass '-static' to libtool, link static with our own libraries, dynamic with system libraries. Link with the bundled zlib.- Modified RPM spec to match new 5.1 debug+max combined community packaging.- Added "client/mysqlslap"- Added zlib to the list of (static) libraries installed - Added check against libtool wierdness (WRT: sql/mysqld || sql/.libs/mysqld) - Compile MySQL with bundled zlib - Fixed %packager name to "MySQL Production Engineering Team"- Avoid using the "bundled" zlib on "shared" builds: As it is not installed (on the build system), this gives dependency problems with "libx5XU<$><<<   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~DIR_COLORSDIR_COLORS.256colorDIR_COLORS.lightbgcolorcolorls.cshcolorls.sh[archbase64basenamecatchconchgrpchmodchowncksumcommcpcsplitcutdatedddfdirdircolorsdirnameduechoenvexpandexprfactorfalsefmtfoldgroupsheadhostididinstalljoinlinklnlognamelsmd5summkdirmkfifomknodmktempmvnicenlnohupnprocnumfmtodpastepathchkpinkyprprintenvprintfptxpwdreadlinkrealpathrmrmdirrunconseqsha1sumsha224sumsha256sumsha384sumsha512sumshredshufsleepsortsplitstatstdbufsttysumsynctactailteetesttimeouttouchtrtruetruncatetsortttyunameunexpanduniqunlinkusersvdirwcwhowhoamiyescoreutilslibstdbuf.sochrootcoreutils-8.22ABOUT-NLSCOPYINGChangeLog.bz2NEWSREADMETHANKSTODOfileutilsChangeLog-1997.bz2ChangeLog.bz2NEWSsh-utilsChangeLog.0.bz2ChangeLog.bz2NEWStextutilsChangeLog.bz2NEWScoreutils.info.gzcoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.mocoreutils.moLC_TIMEcoreutils.moarch.1.gzbase64.1.gzbasename.1.gzcat.1.gzchcon.1.gzchgrp.1.gzchmod.1.gzchown.1.gzchroot.1.gzcksum.1.gzcomm.1.gzcp.1.gzcsplit.1.gzcut.1.gzdate.1.gzdd.1.gzdf.1.gzdir.1.gzdircolors.1.gzdirname.1.gzdu.1.gzecho.1.gzenv.1.gzexpand.1.gzexpr.1.gzfactor.1.gzfalse.1.gzfmt.1.gzfold.1.gzgroups.1.gzhead.1.gzhostid.1.gzid.1.gzinstall.1.gzjoin.1.gzlink.1.gzln.1.gzlogname.1.gzls.1.gzmd5sum.1.gzmkdir.1.gzmkfifo.1.gzmknod.1.gzmktemp.1.gzmv.1.gznice.1.gznl.1.gznohup.1.gznproc.1.gznumfmt.1.gzod.1.gzpaste.1.gzpathchk.1.gzpinky.1.gzpr.1.gzprintenv.1.gzprintf.1.gzptx.1.gzpwd.1.gzreadlink.1.gzrx@%XtWf$|F+?&|d   MHLdhos        8     @ m   X1(\8d;9P;:;>!~@!B!G! H! I! X!Y"Z" ["$\"( ]"L ^"b#"d#e#f#l#t# u$ v$$w% x& y&$&x&&( ( **+ + g+h+Chesiod3.2.13.el7Shared libraries for querying the Hesiod naming serviceHesiod is a system which uses existing DNS functionality to provide access to databases of information that changes infrequently. It is often used to distribute information kept in the /etc/passwd, /etc/group, and /etc/printcap files, among others.SOworker1.bsys.centos.orgCentOSMITCentOS BuildSystem System Environment/Librarieslinuxx86_64,`N9rA큤SOSOSOSOQTQ[LSQ[LSOSO7e2b6d8c7879702e97306ea4017cf1857e653dced4d2d215af81ebf6d6fb0990b9adcd40147995c5a707897f20e06f18b9a28dcf43970e84240a18b14e77e65054e18557133d8748220231e4f84f90acebed03d5fc4f0338087a8b36e0a226cfcbca44f322ef42b2c80fd4323b31b01594c62415627d6c9b305dea586182eaa142e08146c008559cd0a7557a07fddd8cb76268eff2d3fcdcce4bb551d8f82f399216082318707ed339ac0c9f641c27ba490f657e3b53620a00666bc61bb9d3ea6a6064acbb372dec526613ed927d904710a192b138dbf7fd4a4af5fe6dd978aflibhesiod.so.0.0.0rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootroothesiod-3.2.1-3.el7.src.rpmhesiodhesiod(x86-64)libhesiod.so.0()(64bit)@@@@@@@@@@@@   @ /sbin/ldconfig/sbin/ldconfiglibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libhesiod.so.0()(64bit)libidn.so.11()(64bit)libidn.so.11(LIBIDN_1.0)(64bit)libresolv.so.2()(64bit)libresolv.so.2(GLIBC_2.2.5)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.1RURkQ\QPOMRK~}@KMJkJi@I@I5#@HHQHCGDC@D{DLDLD@DD+@D+@D+@C@CCqB8@@Dw@@,@?|>@>@>5@>.>>=@=c=@<@<@< - 3.2.1-3Daniel Mach - 3.2.1-2Nalin Dahyabhai - 3.2.1-1Fedora Release Engineering - 3.1.0-23Fedora Release Engineering - 3.1.0-22Fedora Release Engineering - 3.1.0-21Fedora Release Engineering - 3.1.0-20Nalin Dahyabhai - 3.1.0-19Nalin Dahyabhai - 3.1.0-18Nalin Dahyabhai - 3.1.0-17Fedora Release Engineering - 3.1.0-16Fedora Release Engineering - 3.1.0-15Nalin Dahyabhai - 3.1.0-14Nalin Dahyabhai -xXWHY5j $zj k h        R:RRR$R+R:RR!R:RPPPPPPPRR R R(R8R:RR RR(R5R:P?R R*R9R:P@R:R=PAPBPCPDRR RR2R:R ,r6U|PxXͅ 23+ﯴ@4lk bTȑ-nB-$\ɻr «%uD 2P-oT{M=v'Ru:nH$!{D2g UId~!˩Ap)>V7X(CŽ&o]LH{ZЊNkV$ȶ(~'y ^j,raH~HťI:#扃\yWC"DgDj/#j}H9I bhʏ\&ϲx˹'}J"qC`<-]\#N|$`jZλ{/#'bQARKu̡5S*$ƨ[<?@/1 R)ݕi7ίgD>z 5Z~n!I"n|9|p)S']6IۯـK= 4.1 - don't mark php.ini as noreplace to make upgrades work (#152171) - fix subpackage descriptions (#152628) - fix memset(,,0) in Zend (thanks to Dave Jones) - fix various compiler warnings in Zend- package mysqli extension in php-mysql - really enable pcntl (#142903) - don't build with --enable-safe-mode (#148969) - use "Instant Client" libraries for oci8 module (Kai Bolay, #149873)- fix build with GCC 4- install the ext/gd headers (#145891) - enable pcntl extension in /usr/bin/php (#142903) - add libmbfl array arithmetic fix (dcb314@hotmail.com, #143795) - add BuildRequire for recent pcre-devel (#147448)- update to 5.0.3 (thanks to Robert Scheck et al, #143101) - enable xsl extension (#142174) - package both the xsl and dom extensions in php-xml - enable soap extension, shared (php-soap package) (#142901) - add patches from upstream 5.0 branch: * Zend_strtod.c compile fixes * correct php_sprintf return value usage- update for db4-4.3 (Robert Scheck, #140167) - build against mysql-devel - run tests in %check- truncate changelog at 4.3.1-1 - merge from 4.3.x package: - enable mime_magic extension and Require: file (#130276)- fix dom/sqlite enable/without confusion- fix phpize installation for lib64 platforms - add fix for segfault in variable parsing introduced in 5.0.2- update to 5.0.2 (#127980) - build against mysqlclient10-devel - use new RTLD_DEEPBIND to load extension modules - drop explicit requirement for elfutils-devel - use AddHandler in default conf.d/php.conf (#135664) - "fix" round() fudging for recent gcc on x86 - disable sqlite pending audit of warnings and subpackage split- don't build dom extension into 2.0 SAPI- ExclusiveArch: x86 ppc x86_64 for the moment- fix default extension_dir and conf.d/php.conf- update to 5.0.1 - only build shared modules once - put dom extension in php-dom subpackage again - move extension modules into %{_libdir}/php/modules - don't use --with-regex=system, it's ignored for the apache* SAPIs- Merge in some spec file changes from Jeff Stern (jastern@uci.edu)- bump to 5.0.0 - add patch to prevent clobbering struct re_registers from regex.h - remove domxml references, replaced with dom now built-in - fix php.ini to refer to php5 not php47.3.33-14.el7.remi7.3.33-14.el7.remi7.3.33-14.el7.remi7.3.33-14.el7.remi20-mysqlnd.ini30-mysqli.ini30-pdo_mysql.inimysqli.somysqlnd.sopdo_mysql.so/etc/opt/remi/php73/php.d//opt/remi/php73/root/usr/lib64/php/modules/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuhttps://forum.remirepo.net/?dӕak[]!LΈJ]NoGVf_H NoGV2mk_gqҟUrK*[ݫ;溄Z]!LΈJ]NoGVf_H NoGV ;(njgonQ6wb0O(8݃R{696bd0c7d46f55c1d191e68e32b98ec361f2fdff2g v},g umann) [1107934] - [ethernet] enic: do tx cleanup in napi poll (Stefan Assmann) [1107934] - [ethernet] enic: add low latency socket busy_poll support (Stefan AssmaxXXx$tverbum.org> - 0.78-2Colin Walters - 0.78-1Matthias Clasen - 0.76-4Dan Williams - 0.76-3David Zeuthen - 0.76-2Colin Walters - 0.76-1Dan Williams - 0.74-9Matthias Clasen - 0.74-8Colin Walters - 0.74-7David Zeuthen - 0.74-6David Zeuthen - 0.74-5Dan Williams - 0.74-4Dan Williams - 0.74-3Dan Williams - 0.74-2Ray Strode - 0.74-1Dan Williams - 0.73-4Matthias Clasen - 0.73-3Matthias Clasen - 0.73-2Matthias Clasen - 0.73-1John (J5) Palmieri - 0.71-4David Zeuthen - 0.71-3.el7Matthias Clasen - 0.71-2Matthias Clasen - 0.71-1Jesse Keating - 0.70-4John (J5) Palmieri - 0.70-3John (J5) Palmieri - 0.70-2John (J5) Palmieri - 0.70-1- Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- CVE-2013-0292 (previous patch was not actually applied) - Resolves: #911714- Don't install ChangeLog (need to save space on the live image)- CVE-2013-0292 Resolves: #911714- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Update to 0.100- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Update to 0.92- Rebuilt for gcc bug 634757- Drop .gir file, it's now in gobject-introspection- New upstream version - drop now-merged shadow props patch- Rebuild against new gobject-introspection- Fix shadow property access (fdo #28835)- Add introspection data from gir-repository - Remove unneeded autotools calls- New upstream Drop upstreamed patch- Revert previous broken patch for error names, add better fix- Add patch to avoid assertions when setting a GError that includes a '-' in the enumeration value. Should fix #528897- New upstream Has introspect.xml internally, drop it from here- Add ListActivatableNames to dbus-bus-introspect.xml to help tracker build- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- New upstream 0.82 - Remove mclasen accidental commit of CFLAGS="-O0 -g3"- Minor directory ownership cleanup- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- New upstream release - Adjust to new bash completion dir - Includes patch noreply patch- Add patch to avoid sending reply to noreply messages; this avoids some spurious dbus denial logs during system startup from NM- New upstream release, drop upstreamed patches- Avoid some spurious linkage- Fix crashes when a tracked service restarts too quickly (fdo #18573)- Add bash completion for dbus-send(1)- New upstream 0.76 - Drop all upstreamed patches- Handle unknown object properties without asserting (fdo #16079) - Handle GetAll() property names correctly (fdo #16114) - Enable the freeze-abi patch - Cherry-pick some fixes from upstream git- Fix license field- Ensure ABI is frozen as it stands now- Add another upstreamed patch for setting the default timeout on a proxy- Add an already upstreamed patch to export the GetAll() method on the org.freedesktop.DBus.Properties interface- Ignore children of namespaced nodes too- Ignore namespaces in introspection XML- Actually apply the patch for fdo #12505- Update to 0.74- Dispatch NameOwnerChanged signals to proxies only once (fdo #12505)- Rebuild against new expat- Fix a bug in introspection support (#248150)- Update to 0.73 (#233631) - Drop upstreamed patches- Add dbus-glib-0.70-use-default-threads.patch - Partial fix to #219257- Add dbus-glib-0.70-fix-info-leak.patch - Resolves: #216034- Fix up Requires for the -devel package- Update to 0.71- remove improper obsoletes- Pregenerate the xml introspect file so you don't x XXX$h llation and bundle PEAR DB-1.7.5 package- update to 5.0.4 (#153068) - add .phps AddType to php.conf (#152973) - better gcc4 fix for libxmlrpc- BuildRequire mysql-devel >= 4.1 - don't mark php.ini as noreplace to make upgrades work (#152171) - fix subpackage descriptions (#152628) - fix memset(,,0) in Zend (thanks to Dave Jones) - fix various compiler warnings in Zend- package mysqli extension in php-mysql - really enable pcntl (#142903) - don't build with --enable-safe-mode (#148969) - use "Instant Client" libraries for oci8 module (Kai Bolay, #149873)- fix build with GCC 4- install the ext/gd headers (#145891) - enable pcntl extension in /usr/bin/php (#142903) - add libmbfl array arithmetic fix (dcb314@hotmail.com, #143795) - add BuildRequire for recent pcre-devel (#147448)- update to 5.0.3 (thanks to Robert Scheck et al, #143101) - enable xsl extension (#142174) - package both the xsl and dom extensions in php-xml - enable soap extension, shared (php-soap package) (#142901) - add patches from upstream 5.0 branch: * Zend_strtod.c compile fixes * correct php_sprintf return value usage- update for db4-4.3 (Robert Scheck, #140167) - build against mysql-devel - run tests in %check- truncate changelog at 4.3.1-1 - merge from 4.3.x package: - enable mime_magic extension and Require: file (#130276)- fix dom/sqlite enable/without confusion- fix phpize installation for lib64 platforms - add fix for segfault in variable parsing introduced in 5.0.2- update to 5.0.2 (#127980) - build against mysqlclient10-devel - use new RTLD_DEEPBIND to load extension modules - drop explicit requirement for elfutils-devel - use AddHandler in default conf.d/php.conf (#135664) - "fix" round() fudging for recent gcc on x86 - disable sqlite pending audit of warnings and subpackage split- don't build dom extension into 2.0 SAPI- ExclusiveArch: x86 ppc x86_64 for the moment- fix default extension_dir and conf.d/php.conf- update to 5.0.1 - only build shared modules once - put dom extension in php-dom subpackage again - move extension modules into %{_libdir}/php/modules - don't use --with-regex=system, it's ignored for the apache* SAPIs- Merge in some spec file changes from Jeff Stern (jastern@uci.edu)- bump to 5.0.0 - add patch to prevent clobbering struct re_registers from regex.h - remove domxml references, replaced with dom now built-in - fix php.ini to refer to php5 not php47.3.33-14.el7.remi7.3.33-14.el7.remi20-bcmath.inibcmath.sophp73-php-bcmath-7.3.33libbcmath_COPYING/etc/opt/remi/php73/php.d//opt/remi/php73/root/usr/lib64/php/modules//opt/remi/php73/root/usr/share/licenses//opt/remi/php73/root/usr/share/licenses/php73-php-bcmath-7.3.33/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuhttps://forum.remirepo.net/?E`$gub2*[و]!LΈJ]NoGVf_I NoGVo^:Ա@HID\zU ߂Pr9]A]!LΈJ]NoGVf_I NoGV)#02O__KYxZ|:IxRNn51c3d53e227ee32d2ed1fbebcfb68bedd4e4e96a1g vdg uOlsa) [1425612] - [tools] hw_breakpoint: Allow watchpoint of length 3, 5, 6 and 7 (Jiri Olsa) [1425612] - [x86] perf/x86: Fix exclusion of BTS and LBR for Goldmont (Jiri Olsa) [1425612]- [crypto] tcrypt - Add new mode for sha512_mb (Herbert Xu) [1379518] - [crypto] sha512-mb - Crypto computation (x4 AVX2) (Herbert Xu) [1379518] - [crypto] sha512-mb - Algorithm data structures (Herbert Xu) [1379518] - [crypto] sha512-mb - submit/flush routines for AVX2 (Herbert Xu) [1379518] - [crypto] sha512-mb - Enable SHA512 multibuffer support (Herbert Xu) [1379518] - [crypto] sha512-mb - SHA512 multibuffer job manager and glue code (Herbert Xu) [1379518] - [crypto] tcrypt - Add speed tests for SHA multibuffer algorithms (Herbert Xu) [1379518] - [crypto] sha256-mb xXH`${H ?   ! * X        '( cX lY t   h mQINBFKuaIQBEAC1UphXwMqCAarPUH/ZsOFslabeTVO2pDk5YnO96f+rgZB7xArB OSeQk7B90iqSJ85/c72OAn4OXYvT63gfCeXpJs5M7emXkPsNQWWSju99lW+AqSNm jYWhmRlLRGl0OO7gIwj776dIXvcMNFlzSPj00N2xAqjMbjlnV2n2abAE5gq6VpqP vFXVyfrVa/ualogDVmf6h2t4Rdpifq8qTHsHFU3xpCz+T6/dGWKGQ42ZQfTaLnDM jToAsmY0AyevkIbX6iZVtzGvanYpPcWW4X0RDPcpqfFNZk643xI4lsZ+Y2Er9Yu5 S/8x0ly+tmmIokaE0wwbdUu740YTZjCesroYWiRg5zuQ2xfKxJoV5E+Eh+tYwGDJ n6HfWhRgnudRRwvuJ45ztYVtKulKw8QQpd2STWrcQQDJaRWmnMooX/PATTjCBExB 9dkz38Druvk7IkHMtsIqlkAOQMdsX1d3Tov6BE2XDjIG0zFxLduJGbVwc/6rIc95 T055j36Ez0HrjxdpTGOOHxRqMK5m9flFbaxxtDnS7w77WqzW7HjFrD0VeTx2vnjj GqchHEQpfDpFOzb8LTFhgYidyRNUflQY35WLOzLNV+pV3eQ3Jg11UFwelSNLqfQf uFRGc+zcwkNjHh5yPvm9odR1BIfqJ6sKGPGbtPNXo7ERMRypWyRz0zi0twARAQAB tChGZWRvcmEgRVBFTCAoNykgPGVwZWxAZmVkb3JhcHJvamVjdC5vcmc+iQI4BBMB AgAiBQJSrmiEAhsPBgsJCAcDAgYVCAIJCgsEFgIDAQIeAQIXgAAKCRBqL66iNSxk 5cfGD/4spqpsTjtDM7qpytKLHKruZtvuWiqt5RfvT9ww9GUUFMZ4ZZGX4nUXg49q ixDLayWR8ddG/s5kyOi3C0uX/6inzaYyRg+Bh70brqKUK14F1BrrPi29eaKfG+Gu MFtXdBG2a7OtPmw3yuKmq9Epv6B0mP6E5KSdvSRSqJWtGcA6wRS/wDzXJENHp5re 9Ism3CYydpy0GLRA5wo4fPB5uLdUhLEUDvh2KK//fMjja3o0L+SNz8N0aDZyn5Ax CU9RB3EHcTecFgoy5umRj99BZrebR1NO+4gBrivIfdvD4fJNfNBHXwhSH9ACGCNv HnXVjHQF9iHWApKkRIeh8Fr2n5dtfJEF7SEX8GbX7FbsWo29kXMrVgNqHNyDnfAB VoPubgQdtJZJkVZAkaHrMu8AytwT62Q4eNqmJI1aWbZQNI5jWYqc6RKuCK6/F99q thFT9gJO17+yRuL6Uv2/vgzVR1RGdwVLKwlUjGPAjYflpCQwWMAASxiv9uPyYPHc ErSrbRG0wjIfAR3vus1OSOx3xZHZpXFfmQTsDP7zVROLzV98R3JwFAxJ4/xqeON4 vCPFU6OsT3lWQ8w7il5ohY95wmujfr6lk89kEzJdOTzcn7DBbUru33CQMGKZ3Evt RjsC7FDbL017qxS+ZVA/HGkyfiu4cpgV8VUnbql5eAZ+1Ll6Dw== gpg-pubkey352c64e552ae6884gpg(Fedora EPEL (7) )-----BEGIN PGP PUBLIC KEY BLOCK----- Version: rpm-4.11.3 (NSS-3) mQINBFKuaIQBEAC1UphXwMqCAarPUH/ZsOFslabeTVO2pDk5YnO96f+rgZB7xArB OSeQk7B90iqSJ85/c72OAn4OXYvT63gfCeXpJs5M7emXkPsNQWWSju99lW+AqSNm jYWhmRlLRGl0OO7gIwj776dIXvcMNFlzSPj00N2xAqjMbjlnV2n2abAE5gq6VpqP vFXVyfrVa/ualogDVmf6h2t4Rdpifq8qTHsHFU3xpCz+T6/dGWKGQ42ZQfTaLnDM jToAsmY0AyevkIbX6iZVtzGvanYpPcWW4X0RDPcpqfFNZk643xI4lsZ+Y2Er9Yu5 S/8x0ly+tmmIokaE0wwbdUu740YTZjCesroYWiRg5zuQ2xfKxJoV5E+Eh+tYwGDJ n6HfWhRgnudRRwvuJ45ztYVtKulKw8QQpd2STWrcQQDJaRWmnMooX/PATTjCBExB 9dkz38Druvk7IkHMtsIqlkAOQMdsX1d3Tov6BE2XDjIG0zFxLduJGbVwc/6rIc95 T055j36Ez0HrjxdpTGOOHxRqMK5m9flFbaxxtDnS7w77WqzW7HjFrD0VeTx2vnjj GqchHEQpfDpFOzb8LTFhgYidyRNUflQY35WLOzLNV+pV3eQ3Jg11UFwelSNLqfQf uFRGc+zcwkNjHh5yPvm9odR1BIfqJ6sKGPGbtPNXo7ERMRypWyRz0zi0twARAQAB tChGZWRvcmEgRVBFTCAoNykgPGVwZWxAZmVkb3JhcHJvamVjdC5vcmc+iQI4BBMB AgAiBQJSrmiEAhsPBgsJCAcDAgYVCAIJCgsEFgIDAQIeAQIXgAAKCRBqL66iNSxk 5cfGD/4spqpsTjtDM7qpytKLHKruZtvuWiqt5RfvT9ww9GUUFMZ4ZZGX4nUXg49q ixDLayWR8ddG/s5kyOi3C0uX/6inzaYyRg+Bh70brqKUK14F1BrrPi29eaKfG+Gu MFtXdBG2a7OtPmw3yuKmq9Epv6B0mP6E5KSdvSRSqJWtGcA6wRS/wDzXJENHp5re 9Ism3CYydpy0GLRA5wo4fPB5uLdUhLEUDvh2KK//fMjja3o0L+SNz8N0aDZyn5Ax CU9RB3EHcTecFgoy5umRj99BZrebR1NO+4gBrivIfdvD4fJNfNBHXwhSH9ACGCNv HnXVjHQF9iHWApKkRIeh8Fr2n5dtfJEF7SEX8GbX7FbsWo29kXMrVgNqHNyDnfAB VoPubgQdtJZJkVZAkaHrMu8AytwT62Q4eNqmJI1aWbZQNI5jWYqc6RKuCK6/F99q thFT9gJO17+yRuL6Uv2/vgzVR1RGdwVLKwlUjGPAjYflpCQwWMAASxiv9uPyYPHc ErSrbRG0wjIfAR3vus1OSOx3xZHZpXFfmQTsDP7zVROLzV98R3JwFAxJ4/xqeON4 vCPFU6OsT3lWQ8w7il5ohY95wmujfr6lk89kEzJdOTzcn7DBbUru33CQMGKZ3Evt RjsC7FDbL017qxS+ZVA/HGkyfiu4cpgV8VUnbql5eAZ+1Ll6Dw== =hdPa -----END PGP PUBLIC KEY BLOCK----- RhlocalhostpubkeyFedora EPEL (7) Public Keys(none)gpg(Fedora EPEL (7) )gpg(352c64e5)4.11.34:6a2faea2352c64e5-52ae68844:6a2faea2352c64e5-52ae6884?dd737a402556b7653c2bc971f343532046e26384bbn Zickus) [1303209] - [usb] storage: add unusual-devs entry for BlackBerry 9000 (Don Zickus) [1303209] - [usb] storage: restrict bcdDevice range for Super TopxXVkI${kIjIlI117Dan Horák - 0.8.2-3.git20101117Matthias Clasen - 0.8.2-2.git20101117Dan Williams - 0.8.2-1.git20101117Matthias Clasen - 0.8.1-10.1Dan Williams - 0.8.1-10Dan Williams - 0.8.1-9Dan Williams - 0.8.1-8Dan Williams - 0.8.1-7Dan Williams - 0.8.1-6Dan Williams - 0.8.1-5Dan Williams - 0.8.1-4Dan Williams - 0.8.1-3Dan Williams - 0.8.1-2Dan Williams - 0.8.1-1Matthias Clasen - 0.8.1-0.5Dan Williams - 0.8.1-0.4Dan Williams - 0.8.1-0.3Dan Williams - 0.8.1-0.2.git20100519Dan Williams - 0.8.1-0.1.git20100510Dan Williams - 0.8-13.git20100509Dan Williams - 0.8-12.git20100504Dan Williams - 0.8-11.git20100503Dan Williams - 0.8-10.git20100502Dan Williams - 0.8-9.git20100429Dan Williams - 0.8-8.git20100426Dan Williams - 0.8-7.git20100422Dan Williams - 0.8-6.git20100408Dan Williams - 0.8-5.git20100408Dan Williams - 0.8-4.git20100325Dan Williams - 0.8-3.git20100323Dan Williams - 0.8-2.git20100317Dan Williams - 0.8-1.git20100219Dan Williams - 0.8-0.4.git20100211Kevin Kofler - 0.8-0.3.git20100129Dan Williams - 0.8-0.2.git20100129Dan Williams - 0.8-0.1.git20100122Dan Williams - 0.7.999-2.git20100120Dan Williams - 0.7.999-1.git20100120Dan Williams - 0.7.998-1.git20100106Dan Williams - 0.7.997-2.git20091214Dan Williams - 0.7.997-1Dan Williams - 0.7.996-7.git20091113Dan Williams - 0.7.996-6.git20091021Dan Williams - 0.7.996-5.git20091021Dan Williams - 0.7.996-4.git20091002Dan Williams - 0.7.996-3.git20090928Matthias Clasen - 0.7.996-3.git20090921Dan Williams - 0.7.996-2.git20090921Dan Williams - 0.7.996-1.git20090826Dan Williams - 0.7.995-3.git20090813Bastien Nocera 0.7.995-2.git20090804Dan Williams - 0.7.995-1.git20090804Matthias Clasen - 0.7.995-1.git20090728Dan Williams - 0.7.995-0.git20090728Fedora Release Engineering - 1:0.7.1-9.git20090708Dan Williams - 0.7.1-8.git20090708Dan Williams - 0.7.1-7.git20090708Dan Williams - 0.7.1-6.git20090617Dan Williams - 0.7.1-5.git20090617Karsten Hopp 0.7.1-4.git20090414.1Adam Jackson 1:0.7.1-4.git20090414Dan Williams - 1:0.7.1-3.git20090414Dan Williams - 1:0.7.1-2.git20090414Dan Williams - 1:0.7.1-1Dan Williams - 1:0.7.0.100-2.git20090408Dan Williams - 1:0.7.0.100-1Dan Williams - 1:0.7.0.99-5Dan Williams - 1:0.7.0.99-4Dan Williams - 1:0.7.0.99-3.5Dan Williams - 1:0.7.0.99-3Dan Williams - 1:0.7.0.99-2Dan Williams - 1:0.7.0.99-1Dan Williams - 1:0.7.0.98-1.git20090225Fedora Release Engineering - 1:0.7.0.97-6.git20090220Dan Williams - 1:0.7.0.97-5.git20090220Dan Williams - 1:0.7.0.97-4.git20090219Dan Williams - 1:0.7.0.97-2Dan Williams - 1:0.7.0.97-1Dan Williams #StandWithUkraineGPL-2.0-or-laterRemi ColletDevelopment/Languageslinuxx86_64php70-7.0-1.el7.remi.src.rpmscl-package(php70)php70php70(x86-64)    php70-runtimephp70-php-common(x86-64)php70-php-cli(x86-64)php70-runtime(x86-64)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)7.0-1.el7.remi4.6.0-14.0-13.0.4-15.2-14.11.3d@\mA@\A[~WXVaVm@V@V9@UUUJ@U@U@Remi Collet 7.0-1Remi Collet 2.0-1Remi Collet 1.0-6Remi Collet 1.0-6Remi Collet 1.0-5Remi Collet 1.0-4Remi Collet 1.0-3Remi Collet 1.0-2Remi Collet 1.0-1Remi Collet 1.0-0.5Remi Collet 1.0-0.4Remi Collet 1.0-0.3Remi Collet 1.0-0.2Remi Collet 1.0-0.1- define %scl_vendor and %_scl_prefix in macros.php70-config - redefine %__phpize and %__phpconfig - move man page out of scl tree - improve the man page- add syspaths sub package providing system-wide wrappers- cleanup for EL-8- scl-utils 2.0.2 drop modules support- fix description (PHP 7.0 is stable)- add module file for EL- fix override for pecl_xmldir (F24)- add missing "sbin" in PATH (Fedora)- requires semanage and selinuxenabled commands instead of packages- F23 rebuild with rh_layout- use rh_layout instead of nfsmountable in Fedora- enable nfsmountable (not to be nfs montable) - move configuration dir to /etc/opt - move localstate dir to /var/opt - fix incorrect selinux contexts- fix licenses location - own directories for pecl packages- initial packaging7.0-1.el7.remi7.0-1.el7.remi-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuhttps://forum.remirepo.net/? U:5bÈ]!LΈJ]NoGVd NoGV??׬gΛҰ-KZi!ʈ]!LΈJ]NoGVd NoGV> bp#ψK q oH$17!HH n{3c4cdb3006681a0448357934c9d76fbb359edb69g v&|g u/Fix kernel doc style descriptions in iscsi_iser.h (Amir Vadai) [1164539] - [infiniband] iser: Nit - add space after __func__ in iser logging (Amir Vadai) [1164539] - [infiniband] iser: Change iscsi_conn_stop log level to info (Amir Vadai) [1164539] - [infiniband] iser: Suppress scsi command send completions (Amir Vadai) [1164539] - [infiniband] iser: Optimize completion polling (Amir Vadai) [1164539] - [infiniband] iser: Use beacon to indicate all completions were consumed (Amir Vadai) [1164539] - [infiniband] iser: Use single CQ for RX and TX (Amir Vadai) [1164539] - [infiniband] iser: Use internal polling budget to avoid possible live-lock (Amir Vadai) [1164539] - [infiniband] iser: Centralize iser completion contexts (Amir Vadai) [11645xXWCc$SCcBcDcpdate to 5.5.23RC1- Update to 5.5.22 http://www.php.net/releases/5_5_22.php- Update to 5.5.21 http://www.php.net/releases/5_5_21.php- fix php-fpm.service.d location- update to 5.5.21RC1- Update to 5.5.20 http://www.php.net/releases/5_5_20.php - add sybase_ct extension (in mssql sub-package) - xmlrpc requires xml- Update to 5.5.20 http://www.php.net/releases/5_5_20.php- update to 5.5.20RC1 - add embedded sub package - filter all libraries to avoid provides- FPM: add upstream patch for https://bugs.php.net/68421 access.format=R doesn't log ipv6 address - FPM: add upstream patch for https://bugs.php.net/68420 listen=9000 listens to ipv6 localhost instead of all addresses - FPM: add upstream patch for https://bugs.php.net/68423 will no longer load all pools- Update to 5.5.19 http://www.php.net/releases/5_5_19.php- update to 5.5.19RC1 - new version of systzdata patch, fix case sensitivity - disable opcache.fast_shutdown in default config - add php55-cgi command in base system- Update to 5.5.18 http://www.php.net/releases/5_5_18.php- openssl: fix regression introduce in changes for upstream bug #65137 and #41631, revert to 5.5.16 behavior- Update to 5.5.17 http://www.php.net/releases/5_5_17.php - fpm: fix script_name with mod_proxy_fcgi / proxypass add upstream patch for https://bugs.php.net/65641 - add system php library to default include_path- update to 5.5.16 - cleanup, merge with spec from remi repository - enable most extensions- fileinfo: fix out-of-bounds memory access CVE-2014-2270 - fileinfo: fix extensive backtracking CVE-2013-7345- gd: fix NULL deref in imagecrop CVE-2013-7327 - gd: drop vpx support, fix huge memory consumption #1075201- fix patch name - fix memory leak introduce in patch for CVE-2014-1943 - fix heap-based buffer over-read in DateInterval CVE-2013-6712- fix infinite recursion in fileinfo CVE-2014-1943- fix heap overflow vulnerability in imagecrop CVE-2013-7226- allow multiple paths in ini_scan_dir #1058161- add security fix for CVE-2013-6420- rebuild with test enabled - add dependency on php-pecl-jsonc- update to PHP 5.5.6 - buildstrap build- update to PHP 5.5.5 - mod_php only for httpd24- update to PHP 5.5.4 - improve security, use specific soap.wsdl_cache_dir use /var/lib/php/wsdlcache for mod_php and php-fpm - sync short_tag comments in php.ini with upstream - relocate RPM macro- update to PHP 5.5.3 - improve system libzip patch - fix typo and add missing entries in php.ini- update to PHP 5.5.1 for php55 SCL- rebuild for new httpd-mmn value- remove ZTS conditional stuf for ligibility - add mod_php for apache 2.4 (from httpd24 collection)- improve mod_php, pgsql and ldap description - add missing man pages (phar, php-cgi) - add provides php(pdo-abi) for consistency with php(api) and php(zend-abi) - use %__isa_bits instead of %__isa in ABI suffix #985350- add security fix for CVE-2013-4113 - add missing ASL 1.0 license- run tests during build- rebase to 5.4.16 - fix hang in FindTishriMolad(), #965144 - patch for upstream Bug #64915 error_log ignored when daemonize=0 - patch for upstream Bug #64949 Buffer overflow in _pdo_pgsql_error, #969103 - patch for upstream bug #64960 Segfault in gc_zval_possible_root- remove wrappers in /usr/bin (#966407)- rebuild for libjpeg (instead of libjpeg_turbo) - fix unowned dir %{_datadir}/fpm and %{_libdir}/httpd (#956221)- update to 5.4.14 - clean old deprecated options- update to 5.4.13 - security fixes for CVE-2013-1635 and CVE-2013-1643 - make php-mysql package optional (and disabled) - make ZTS build optional (and disabled) - always try to load mod_php (apache warning is usefull) - Hardened build (links with -z now option) - Remove %config from /etc/rpm/macros.php- update to 5.4.11 - fix php.conf to allow MultiViews managed by php scripts- update to 5.4.10 - remove patches merged upstream - drop "Configure Command" from phpinfo output - prevent php_config.h changes across (otherwise identical) rebuilds- update to 5.4.9- fix php.conf- filter private shared in _httpd_xhX|W?G$WGFH Johnson - fix pmtu discovery for ipv6 (#1444281)- IPv4 vs IPv6 inconsistency on return value of ping (#1362388) - ping6 does not use device specified with -I parameter (#1371824, #1424965) - double cap_free call in ping_common.c (#1410114) - ping assumes EACCESS errors are due to broadcast addresses (#1387315) - ping -t with multicast address without effect on ppc64 (#1373333) - arping -c does not exit when the device is deleted (#1387542)- arping documentation inconsistency (#1351704)- ping hung when it cannot receive echo reply (#1362463) - arping documentation inconsistency (#1351704)- ping does not use device specified with -I parameter (#1351540)- add missing /bin/ping6 (#1355674)- reorder -I option parsing (#1337598)- inconsistent ping behaviour and hang with too large packet size (#1172084)- ping IPv4 addresses by default when given a name (#1317796)- Update to iputils-s20160308 (#1273336)- Update to iputils-s20150815 (#1273336)- ping returns odd results with options inet6 in resolv.conf (#1210331) - count of "back" is not correct in tracepath (#1208372)- ping does not work in dkr images (#1142311)- Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- Harden the package even more (full RELRO) (#983259)- Harden the package- Always use posix locale when reading -i (#905840) - Set correct ninfod capabilities- Update to iputils-s20121207 (#890397) and remove unnecessary patches- Update to iputils-s20121207 (#884983) - fixes a ping segfault introduced by the previous update - Update ninfod-minor patch - Renumber patches - Fix -F switch (flowlabel patch)- Update to iputils-s20121205 (#884436) and remove unnecessary patches- Package ninfod (#877530) - Update systemd requirements- Comment patches and cleanup - Update ifaddrs patch - Call usage() before limiting capabilities - Correct ifaddrs patch - Drop corr_type patch (gcc 4.4 build hack) - Fix missing end tags in sgml documentation- Update to iputils-s20121125 (#879952)- Re-fix arping's default device search logic (#879807)- Update to iputils-s20121121, drop unnecessary patches - Add capabilities to clockdiff and arping - Renumber patches - Fix arping's default device search logic- Update License field- Update to iputils-s20121112 (#875767) + drop unnecessary patches + update patches + wrap SO_BINDTODEVICE with the correct capability + fix incorrect free (hits when -lidn is used)- Update ifenslave tarball (#859182)- Update to iputils-s20121106 (#873571) and update patches- Update to iputils-s20121011 + drop unnecessary patches + update patches + improve spec- Improve spec for fedora - Add systemd-rpm macros (#850167)- Minor update: capabilities patch- Make fedora-review friendly- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Ping fixes: + enable marking packets when the correct capabilities are set (#802197) + integer overflow (#834661) + Fallback to numeric addresses while exiting (#834661)- install everything in /usr https://fedoraproject.org/wiki/Features/UsrMove- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- fixes #756439 - ping Record Route report incorrect (same route)- fixes #752397 - arping uses eth0 as default interface- rebuild for libcap- fixes #697532 - The SysV initscript should be packaged into subpackage- fixes #663734 - ping/ping6 man page fixes - fixes #673831 - tracepath/tracepath6 manpage fixes- fixes build errors due to unused variables- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- fixes #670380 - added /etc/sysconfig/rdisc, modified initscript - initscript moved to git- fixes #662720 - Providing native systemd file - freeing memory when capabilities are dropped- applied patch dropping capabilities of Ludwig Nussel - fixes building ping, pinpg6 with -pie option - moves most CFLAGS options from spec to Makefile- fixes #646444 - Replace SETUID in spec file with the correct file capabilities- update to latest upstream- applied patch preventing ping against dos attack- fixxXWHU$fect.org> 7.0.7-1Remi Collet 7.0.7-0.1.RC1Remi Collet 7.0.6-3Remi Collet 7.0.6-1Remi Collet 7.0.6-0.1.RC1Remi Collet 7.0.5-2Remi Collet 7.0.5-1Remi Collet 7.0.5-0.1.RC1Remi Collet 7.0.4-2Remi Collet 7.0.4-1Remi Collet 7.0.4-0.1.RC1Remi Collet 7.0.3-1Remi Collet 7.0.3-0.2.RC1Remi Collet 7.0.3-0.1.RC1Remi Collet 7.0.2-1Remi Collet 7.0.2-0.1.RC1Remi Collet 7.0.1-1Remi Collet 7.0.1-0.1.RC1Remi Collet 7.0.0-3Remi Collet 7.0.0-2Remi Collet 7.0.0-1Remi Collet 7.0.0-0.16.RC8Remi Collet 7.0.0-0.12.RC8Remi Collet 7.0.0-0.11.RC7Remi Collet 7.0.0-0.10.RC7Remi Collet 7.0.0-0.9.RC6Remi Collet 7.0.0-0.8.RC5Remi Collet 7.0.0-0.7.RC5Remi Collet 7.0.0-0.6.RC4Remi Collet 7.0.0-0.5.RC3Remi Collet 7.0.0-0.4.RC2Remi Collet 7.0.0-0.3.RC1Remi Collet 7.0.0-0.2.beta3Remi Collet 7.0.0-0.1.beta2Remi Collet 5.6.11-1Remi Collet 5.6.10-1.1Remi Collet 5.6.10-1Remi Collet 5.6.9-1Remi Collet 5.6.8-1Remi Collet 5.6.7-2Remi Collet 5.6.7-1Remi Collet 5.6.6-1.1Remi Collet 5.6.6-1Remi Collet 5.6.5-1Remi Collet 5.6.5-0.1.RC1Remi Collet 5.6.4-2Remi Collet 5.6.4-1Remi Collet 5.6.4-0.1.RC1Remi Collet 5.6.3-3Remi Collet 5.6.3-1Remi Collet 5.6.3-0.4.RC1Remi Collet 5.6.3-0.3.RC1Remi Collet 5.6.3-0.2.RC1Remi Collet 5.6.3-0.1.RC1Remi Collet 5.6.1-1Remi Collet 5.6.1-1Remi Collet 5.6.1-0Remi Collet 5.6.1-0.2.RC1Remi Collet 5.6.1-0.1.RC1Remi Collet 5.6.0-1.2Remi Collet 5.6.0-1.1Remi Collet 5.6.0-1Remi Collet 5.6.0-0.22.RC4Remi Collet 5.6.0-0.21.RC4Remi Collet 5.6.0-0.20.RC3Remi Collet 5.6.0-0.18.RC2Remi Collet 5.6.0-0.17.RC2Remi Collet 5.6.0-0.16.RC2Remi Collet 5.6.0-0.15.RC1Remi Collet 5.6.0-0.14.RC1Remi Collet 5.6.0-0.13.RC1Remi Collet 5.6.0-0.12.beta4Remi Collet 5.6.0-0.11.beta4Remi Collet 5.6.0-0.10.beta4Remi Collet 5.6.0-0.9.beta4Remi Collet 5.6.0-0.8.beta3Remi Collet 5.6.0-0.8.201405061030Remi Collet 5.6.0-0.7.beta2Remi Collet 5.6.0-0.6.beta1Remi Collet 5.6.0-0.5.201404090430Remi Collet 5.6.0-0.4.201403261230Remi Collet 5.6.0-0.4.201403170630Remi Collet 5.6.0-0.3.201403120830Remi Collet 5.6.0-0.2.alpha3Remi Collet - 4.11.3-42Pavlina Moravcova Varekova - 4.11.3-41Pavlina Moravcova Varekova - 4.11.3-40Tomas Orsava - 4.11.3-39Pavlina Moravcova Varekova - 4.11.3-38Pavlina Moravcova Varekova - 4.11.3-37Pavlina Moravcova Varekova - 4.11.3-36Pavlina Moravcova Varekova - 4.11.3-35Pavlina Moravcova Varekova - 4.11.3-34Pavlina Moravcova Varekova - 4.11.3-33Panu Matilainen - 4.11.3-32Panu Matilainen - 4.11.3-31Florian Festi - 4.11.3-30Florian Festi - 4.11.3-29Florian Festi - 4.11.3-28Igor Gnatenko - 4.11.3-27Igor Gnatenko - 4.11.3-26Panu Matilainen - 4.11.3-25Florian Festi - 4.11.3-24Florian Festi - 4.11.3-22Florian Festi - 4.11.3-21Florian Festi - 4.11.3-20Florian Festi - 4.11.3-18Pavol Babincak - 4.11.3-17.2Pavol Babincak - 4.11.3-17.1Florian Festi - 4.11.3-17Florian Festi - 4.11.3-16Florian Festi - 4.11.3-15Florian Festi - 4.11.3-14Florian Festi - 4.11.3-13Florian Festi - 4.11.3-12Florian Festi - 4.11.3-11Florian Festi - 4.11.3-10Florian Festi - 4.11.3-9Florian Festi - 4.11.3-8Florian Festi - 4.11.3-7Florian Festi - 4.11.3-6Florian Festi - 4.11.3-5Florian Festi - 4.11.3-4Florian Festi - 4.11.3-3Florian Festi - 4.11.3-2Florian Festi - 4.11.3-1Florian Festi - 4.11.1-25Florian Festi - 4.11.1-24Panu matilainen - 4.11.1-23Panu matilainen - 4.11.1-22Panu matilainen - 4.11.1-21Panu matilainen - 4.11.1-20Aldy Hernandez - 4.11.1-19Aldy Hernandez - 4.11.1-18Aldy Hernandez - 4.11.1-17Panu Matilainen - 4.11.1-16Panu Matilainen - 4.11.1-15Panu Matilainen - 4.11.1-14Daniel Mach - 4.11.1-13Panu Matilainen - 4.11.1-12Panu Matilainen - 4.11.1-11Daniel Mach - 4.11.1-10Florian Festi - 4.11.1-9Panu Matilainen - 4.11.1-8Panu Matilainen - 4.11.1-7Florian Festi - 4.11.1-6Florian Festi - 4.11.1-5Florian Festi - 4.11.1-4Florian Festi - 4.11.1-3Panu Matilainen - 4.11.1-2Panu Matilainen - 4.11.1-1Panu Matilainen - 4.11.0.1-2Panu Matilainen - 4.11.0.1-1Panu Matilainen - 4.11.0-0.beta1.3Panu Matilainen - 4.11.0-0.beta1.2Panu Matilainen - 4.11.0-0.beta1.1Panu Matilainen - 4.10.90-0.git11989.3Panu Matilainen - 4.10.90-0.git11989.2Panu Matilainen - 4.10.90-0.git11989.1Panu Matilainen - 4.10.1-3Panu Matilainen - 4.10.1-2Panu Matilainen - 4.10.1-1Panu Matilainen - 4.10.0-6Fedora Release Engineering - 4.10.0-5.1Panu Matilainen - 4.10.0-5Panu Matilainen - 4.10.0-4Panu Matilx^XWXo$/ php.conf, no need to be relocated- clarify Licenses - missing provides xmlreader and xmlwriter - change php embedded library soname version to 5.4- fix mysql_sock macro definition- fix standard build (non scl)- fix installed headers- use libldap_r for ldap extension- add missing scl_prefix in some provides/requires- make php-enchant optionnal, not available on RHEL-5 - make php-recode optionnal, not available on RHEL-5 - disable t1lib on RHEL-5- enable tidy on RHEL-6 only - re-enable unit tests- minor macro fixes for RHEL-5 build - update autotools workaround for RHEL-5 - use readline when libedit not available (RHEL-5)- update to 5.4.8 - define both session.save_handler and session.save_path - fix possible segfault in libxml (#828526) - use SKIP_ONLINE_TEST during make test - php-devel requires pcre-devel and php-cli (instead of php) - provides php-phar - update systzdata patch to v10, timezone are case insensitive- php-fpm: create apache user if needed - php-cli: provides cli command in standard root (scl)- add configtest option to init script - test configuration before service reload - fix php-fpm service relocation - fix php-fpm config relocation - drop embdded subpackage for scl- missing requires on scl-runtime - relocate /var/lib/session - fix php-devel requires - rename, but don't relocate macros.php- initial spec rewrite for scl build- fix typo in systemd macro- php-fpm: enable PrivateTmp - php-fpm: new systemd macros (#850268) - php-fpm: add upstream patch for startup issue (#846858)- systemd integration, https://bugs.php.net/63085 - no odbc call during timeout, https://bugs.php.net/63171 - check sqlite3_column_table_name, https://bugs.php.net/63149- most failed tests explained (i386, x86_64)- fix for http://bugs.php.net/63126 (#783967)- patch to ensure we use latest libdb (not libdb4)- really fix rhel tests (use libzip and libdb)- fix test to enable zip extension on RHEL-7- remove session.save_path from php.ini move it to apache and php-fpm configuration files- update to 5.4.7 http://www.php.net/releases/5_4_7.php - php-fpm: don't daemonize- enable php-fpm on secondary arch (#849490)- update to 5.4.6 - update to v9 of systzdata patch - backport fix for new libxml- update to 5.4.5- also provide php(language)%{_isa} - define %{php_version}- drop BR for libevent (#835671) - provide php(language) to allow version check- add missing provides (core, ereg, filter, standard)- update to 5.4.4 (CVE-2012-2143, CVE-2012-2386) - use /usr/lib/tmpfiles.d instead of /etc/tmpfiles.d - use /run/php-fpm instead of /var/run/php-fpm- update to 5.4.3 (CVE-2012-2311, CVE-2012-2329)- update to 5.4.2 (CVE-2012-1823)- update to 5.4.1- rebuild for new icu - switch (conditionally) to libdb-devel- fix Loadmodule with MPM event (use ZTS if not MPM worker) - split conf.d/php.conf + conf.modules.d/10-php.conf with httpd 2.4- rebuild for missing automatic provides (#807889)- really use _httpd_mmn- rebuild against httpd 2.4 - use _httpd_mmn, _httpd_apxs macros- update to PHP 5.4.0 finale- update to PHP 5.4.0RC8- update to PHP 5.4.0RC7 - provides env file for php-fpm (#784770) - add patch to use system libzip (thanks to spot) - don't provide INSTALL file- all binaries in /usr/bin with zts prefix- update to PHP 5.4.0RC6 https://fedoraproject.org/wiki/Features/Php54- fix systemd unit- switch to systemd- Rebuild for new libpng- rebuild with new gmp without compat lib- rebuild with new gmp- revert is_a() to php <= 5.3.6 behavior (from upstream) with new option (allow_string) for new behavior- add mysqlnd sub-package - drop patch4, use --libdir to use /usr/lib*/php/build - add patch to redirect mysql.sock (in mysqlnd)- update to 5.3.8 http://www.php.net/ChangeLog-5.php#5.3.8- update to 5.3.7 http://www.php.net/ChangeLog-5.php#5.3.7 - merge php-zts into php (#698084)- rebuild for net-snmp SONAME bump- enable mhash extension (emulated by hash extension)- rebuild for new MySQL client library- update to 5.3.6 http://www.php.net/ChangeLog-5.php#5.3.6 - fix pxHNXVxiI$yiIhIjI - 1:0.9.9.1-31.git20140326Jiří Klimeš - 1:0.9.9.1-30.git20140326Dan Williams - 1:0.9.9.1-29.git20140326Dan Winship - 1:0.9.9.1-28.git20140326Dan Williams - 1:0.9.9.1-27.git20140326Thomas Haller - 1:0.9.9.1-26.git20140326Jiří Klimeš - 1:0.9.9.1-25.git20140326Thomas Haller - 1:0.9.9.1-24.git20140326Thomas Haller - 1:0.9.9.1-23.git20140326Thomas Haller - 1:0.9.9.1-22.git20140326Jiří Klimeš - 1:0.9.9.1-21.git20140326Jiří Klimeš - 1:0.9.9.1-20.git20140326Jiří Klimeš - 1:0.9.9.1-19.git20140326Jiří Klimeš - 1:0.9.9.1-18.git20140326Jiří Klimeš - 1:0.9.9.1-17.git20140326Jiří Klimeš - 1:0.9.9.1-16.git20140326Dan Williams - 1:0.9.9.1-15.git20140326Dan Winship - 1:0.9.9.1-14.git20140326Dan Williams - 1:0.9.9.1-13.git20140326Dan Williams - 1:0.9.9.1-12.git20140326Dan Williams - 1:0.9.9.1-11.git20140326Dan Winship - 1:0.9.9.1-10.git20140326Dan Williams - 1:0.9.9.1-9.git20140326Dan Williams - 1:0.9.9.1-8.git20140326Dan Winship - 1:0.9.9.1-7.git20140313Dan Winship - 1:0.9.9.1-6.git20140313Dan Winship - 1:0.9.9.1-5.git20140313Dan Williams - 1:0.9.9.1-4.git20140313Dan Williams - 1:0.9.9.1-3.git20140313Jiří Klimeš - 1:0.9.9.1-2.git20140228Dan Winship - 1:0.9.9.1-1.git20140228Thomas Haller - 1:0.9.9.1-0.git20140228Dan Williams - 1:0.9.9.0-39.git20140131Dan Williams - 1:0.9.9.0-38.git20140131Dan Winship - 1:0.9.9.0-37.git20140131Dan Williams - 1:0.9.9.0-36.git20140127Daniel Mach - 1:0.9.9.0-35.git20140122Dan Winship - 1:0.9.9.0-34.git20140122Dan Winship - 1:0.9.9.0-33.git20140122Dan Williams - 1:0.9.9.0-32.git20140122Dan Winship - 1:0.9.9.0-31.git20140108Dan Williams - 1:0.9.9.0-30.git20130108Daniel Mach - 1:0.9.9.0-29.git20131212Dan Williams - 0.9.9.0-28.git20131212Dan Winship - 0.9.9.0-27.git20131108Dan Winship - 0.9.9.0-26.git20131108Dan Williams - 0.9.9.0-25.git20131108Dan Williams - 0.9.9.0-24.git20131108Dan Williams - 0.9.9.0-23.git20131108Dan Williams - 0.9.9.0-22.git20131108Dan Williams - 0.9.9.0-21.git20131108Dan Williams - 0.9.9.0-20.git20131108Dan Williams - 0.9.9.0-19.git20131108Dan Winship - 0.9.9.0-18.git20131011Dan Winship - 0.9.9.0-17.git20131011Dan Williams - 0.9.9.0-16.git20131011Dan Williams - 0.9.9.0-15.git20131004Dan Williams - 0.9.9.0-14.git20131003Dan Winship - 0.9.9.0-13.git20131001Bill Nottingham - 0.9.9.0-12.git20130913Dan Williams - 0.9.9.0-11.git20130913Dan Williams - 0.9.9.0-10.git20130906Dan Williams - 0.9.9.0-9.git20130807Dan Winship - 0.9.9.0-8.git20130724Dan Williams - 0.9.9.0-7.git20130724Dan Winship - 0.9.9.0-6Dan Winship - 0.9.9.0-5Jiří Klimeš - 0.9.9.0-4.git20130603Dan Williams - 0.9.9.0-3.git20130603Dan Williams - 0.9.9.0-2.git20130515Dan Williams - 0.9.9.0-1.git20130514Dax=XXPPHR $ B(?d  f8<TX_p    .  D  p  ;  H t   4\(89,: G 8 H d I X Y \ ] ^bbEdeflt u, vXw x0 y\     g h$Cperl-IO-Socket-IP0.215.el7Drop-in replacement for IO::Socket::INET supporting both IPv4 and IPv6This module provides a protocol-independent way to use IPv4 and IPv6 sockets, as a drop-in replacement for IO::Socket::INET. Most constructor arguments and methods are provided in a backward-compatible way.ZXUx86-01.bsys.centos.orgTQCentOSGPL+ or ArtisticCentOS BuildSystem Development/Librarieshttp://search.cpan.org/dist/IO-Socket-IP/linuxnoarch5GD A큤A큤AA큤ZXUQy2BQy2BZXSQy2BQy2BQy2BZXSZXSZXSZXS06300a689fe6e6655726b09c1b0246fe3c1f374bddef7f2fefc30c4364b12eb550164ded41825537f235ad6afa3d1d6d6988fa54f182f664bf9d6417b5997faf8cbc07fe846733cd83e1d47fba404f07c1ac9c87924a48b17e56bade9b78bd46d75939c1dc15c8f4ea6d7b63bf9cf6be157e17a8b2ede5d50954d80fdab7f8e477b89eca38121592e6de66b96b5b5391bc2fa1d15dc848eed79bfd233d12e5e53607219f22b282c32dc17715b130ea48d882fa39d5b94bbc8a41bb08ef5b47b78bceeb6acf03bdb72ed942b1e7e139dd0121f6aa89f2a6595d2c2a81165bcfaarootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-IO-Socket-IP-0.21-5.el7.src.rpmperl(IO::Socket::IP)perl-IO-Socket-IP@@@@@@ @@@@    perl(:MODULE_COMPAT_5.16.3)perl(Carp)perl(Errno)perl(IO::Socket)perl(IO::Socket::IP)perl(POSIX)perl(Socket)perl(base)perl(constant)perl(strict)perl(warnings)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)1.973.0.4-14.6.0-14.0-15.2-14.11.3Y@RkQQQ~`QnQ?QPP@P4P H@OG@ORO OiOOF@O@O`@O"Petr Pisar - 0.21-5Daniel Mach - 0.21-4Petr Šabata - 0.21-3Petr Pisar - 0.21-2Petr Šabata - 0.21-1Petr Šabata - 0.20-1Petr Šabata - 0.19-1Fedora Release Engineering - 0.18-2Petr Šabata - 0.18-1Petr Šabata - 0.17-2Petr Šabata - 0.17-1Fedora Release Engineering - 0.16-3Petr Pisar - 0.16-2Petr Šabata - 0.16-1Petr Šabata - 0.15-1Petr Šabata - 0.14-1Petr Pisar - 0.11-2Petr Šabata - 0.11-1Petr Šabata - 0.10-1Petr Šabata - 0.09-1Petr Šabata 0.08-1- Fix constructing sockets without specifying host or family (bug #1492760)- Mass rebuild 2013-12-27- Disable the SO_REUSEPORT test; koji builders don't support this feature yet- Perl 5.18 rebuild- 0.21 bump- 0.20 bump- 0.19 bump- Rebuilx8-X XpXM$u need dbus running during the build- Spec file cleanups- Initial dbus-glib package/sbin/ldconfig/sbin/ldconfig0.100-7.el70.100-7.el7dbus-binding-toollibdbus-glib-1.so.2libdbus-glib-1.so.2.2.2dbus-glib-0.100COPYINGNEWS/usr/bin//usr/lib64//usr/share/doc//usr/share/doc/dbus-glib-0.100/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB executable, x86-64, version 1 (SYSV), dynamically linked (uses shared libs), for GNU/Linux 2.6.32, BuildID[sha1]=0x9e14e4654a0c8fd33efb239bad25a3c4dea6659e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=0x9ba9508a90034eefb9081f31faed11e5a7e207c9, strippeddirectoryPascal source, UTF-8 Unicode textUTF-8 Unicode text RRRR RR R R R RRPRRRRR R R RR?`̉S$ƨSVe>AK ZHBU$)H;SZ a:lUmVQ-x;yu6L>R 0CRyi3aly҂Vq1-9,CDcSsetCӘS33iGwNyJqZ+Y_Eq>zZ띰+Io,^z\ǩl,^J&3V`aU)YS d+(`?Z  s4]K.AT?DNa Al#6k4g*;LqaQyRӀp$k}ny3 BB hßK%id3aϹgCp*b +~(GUm6pOpпbFQŇئfBdÛRBjAl16'dwMDeƉS$ƨ;*oB=uOOlIe!G4&ah.ܸB l?Y |˴Y>DuGH2*i/N+ogtIJWAZ-Bc_^FjIvGfmqsuk3xюAe:.hk2N .$Pw"[pKXoӧ>]ʜlB0!O#@@{ d?A:ɵlnI/fXX^b,FWMjQk9L vdN4ѿ^&?dЎe:1݁GJp$_V E b2bY4Ý9 c iИD1d144f3e96982fed47c4e94fde884e48172b8c3bbgb1from upstream- More fixes for xen- Fix anaconda transitions- yet more xen rules- more xen rules- Fixes for Samba- Fixes for xen- Allow setroubleshootd to send mail- Add nagios policy- fixes for setroubleshoot- Added Paul Howarth patch to only load policy packages shipped with this package - Allow pidof from initrc to ptrace higher level domains - Allow firstboot to communicate with hal via dbus- Add policy for /var/run/ldapi- Fix setroubleshoot policy- Fixes for mls use of ssh - named has a new conf file- Fixes to make setroubleshoot work- Cups needs to be able to read domain state off of printer client- add boolean to allow zebra to write config files- setroubleshootd fixes- Allow prelink to read bin_t symlink - allow xfs to read random devices - Change gfs to support xattr- Remove spamassassin_can_network boolean- Update to upstream - Fix lpr domain for mls- Add setroubleshoot policy- Turn off auditallow on setting booleans- Multiple fixes- Update to upstream- Update to upstream - Add new class for kernel key ring- Update to upstream- Update to upstream- Break out selinux-devel package- Add ibmasmfs- Fix policygentool gen_requires- Update from Upstream- Fix spec of realplay- Update to upstream- Fix semanage- Allow useradd to create_home_dir in MLS environment- Update from upstream- Update from upstream- Add oprofilefs- Fix for hplip and Picasus- Update to upstream- Update to upstream- fixes for spamd- fixes for java, openldap and webalizer- Xen fixes- Upgrade to upstream- allow hal to read boot_t files - Upgrade to upstream- allow hal to read boot_t files- Update from upstream- Fixes for amavis- Update from upstream- Allow auditctl to search all directxXWXz,$+0eb9b4dbce54d0bda8f92ecb1c0acc03c31512a100924379a0fc544022b1c49166fd3d6898f352b9a47ca64829fadcba8cbc70f7d5e46b651515cff0b25dd5f0fa8bf96a10e97585b5816b775a1e5eecc0290f6f0ef7d3e58543a9dc79e5aebdac1f77b1523b16e04efdde9c2dd3d31ddb41d51cd579aa5661fcc8b5b104a0ea978ed7a94bce96f910927735888117e43b712ec04843103c5a86ef8d1ba83e9a282898b7e00f4149f7f6cd87b267dfed949457814f987205f6b5642a0d8bffbc4740c86d24daa145163b1b300d45d23f04d8da50e3b4faa4476e9cce380472f6a63ec9ebbe5d4b657948d37ab6b1c3a9c99f5a93866fd617444090d210952298be0e5448733b3c5ff7af855cefa112a41814dd73ebe240adcd14e727e3b800ee51624637535959a1f10dbfd2a364d479bd7249fc9d1bd7bbae1b73c07d6f429827985d273cf40d7abafef39e3fb0203e401b26209233111e48a93b0a562eb0971c8acf0c9d4a40424d78ae83beea288f7e53472aa87c55e9ab3d7463467f1737d7b2994e90437471db95ca5c1ab8f8be1946d290a680d3aae5a2037b003841b461a88fdaf1f19013d704e5759669b4c8744d3fa83dfc84df4c008fdce19f4f2c45fd7caf592769d0eebdb8ae564c952792017ec680e2edd30443642216eb9f8a3d8fa166c0cb628c193657d8dfd6cfd1c52281ef333da17bbc95fc7ef1f545470f47f66b9c04cb9f5164b07d0490c5ca629ae8a57e5d85e8abf3992a50d3c1b0e5665659155fabe4af2ab12bf6c7e7b4e35886b0ab6dd6fb2db1a3cfd2bd1c2a422b9d9aa05be33a9@@@rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootebtables-2.0.10-16.el7.src.rpmconfig(ebtables)ebtablesebtables(x86-64)libebt_802_3.so()(64bit)libebt_AUDIT.so()(64bit)libebt_among.so()(64bit)libebt_arp.so()(64bit)libebt_arpreply.so()(64bit)libebt_ip.so()(64bit)libebt_ip6.so()(64bit)libebt_limit.so()(64bit)libebt_log.so()(64bit)libebt_mark.so()(64bit)libebt_mark_m.so()(64bit)libebt_nat.so()(64bit)libebt_nflog.so()(64bit)libebt_pkttype.so()(64bit)libebt_redirect.so()(64bit)libebt_standard.so()(64bit)libebt_stp.so()(64bit)libebt_ulog.so()(64bit)libebt_vlan.so()(64bit)libebtable_broute.so()(64bit)libebtable_filter.so()(64bit)libebtable_nat.so()(64bit)libebtc.so()(64bit)@ @@@@@@@@@@@@@@@@@@@@@@@@@@@@   @ /bin/bash/bin/sh/bin/sh/bin/shconfig(ebtables)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libebt_802_3.so()(64bit)libebt_AUDIT.so()(64bit)libebt_among.so()(64bit)libebt_arp.so()(64bit)libebt_arpreply.so()(64bit)libebt_ip.so()(64bit)libebt_ip6.so()(64bit)libebt_limit.so()(64bit)libebt_log.so()(64bit)libebt_mark.so()(64bit)libebt_mark_m.so()(64bit)libebt_nat.so()(64bit)libebt_nflog.so()(64bit)libebt_pkttype.so()(64bit)libebt_redirect.so()(64bit)libebt_standard.so()(64bit)libebt_stp.so()(64bit)libebt_ulog.so()(64bit)libebt_vlan.so()(64bit)libebtable_broute.so()(64bit)libebtable_filter.so()(64bit)libebtable_nat.so()(64bit)libebtc.so()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)systemdsystemdsystemdrpmlib(PayloadIsXz)2.0.10-16.el73.0.4-14.6.0-14.0-15.2-14.11.3Y|Wu W;S@RUR@RkRxQJ@Q@P@O}@O - 2.0.10-16Thomas Woerner - 2.0.10-15Thomas Woerner -x( XU0<$8<<<u --help output- fix several date issues(e.g. countable dayshifts, ignoring some cases of relative offset, locales conversions...) - clarify ls exit statuses documentation (#446294)- cp -Z now correctly separated in man page (#466646) - cp -Z works again (#466653) - make preservation of SELinux CTX non-mandatory for preserve=all cp option- remove unimplemented (never accepted by upstream) option for chcon changes only. Removed from help and man. - remove ugly lzma hack as lzma is now supported by setup macro- fix up potential test failures when building in certain slightly quirky environments (part of bz#442352)- added requires for libattr (#465569)- seq should no longer fail to display final number of some float usages of seq with utf8 locales(#463556)- mention that DISPLAY and XAUTHORITY envvars are preserved for pam_xauth in su -l (#450505)- ls -U1 now uses constant memory- dd: iflag=fullblock now read full blocks if possible (#431997, #449263) - ls: --color now highlights files with capabilities (#449985)- Get rid off fuzz in patches- fix authors for basename and echo - fix who info pages, print last runlevel only for printable chars- print verbose output of chcon with newline after each message (#451478)- workaround for koji failures(#449910, #442352) now preserves timestamps correctly - fallback to supported functions, added test case - runuser binary is no longer doubled in /usr/bin/runuser- workaround for strange koji failures(#449910,#442352) - fixed ls -ZC segfault(#449866, introduced by 6.10-1 SELinux patch reworking)- New upstream release 6.12, adapted patches- fix SHA256/SHA512 to work on sparc- fixed a HUGE memory leak in install binary(#447410)- added arch utility (from util-linux-ng) - do not show executable file types without executable bit in colored ls as executable- Do not show misleading scontext in id command when user is specified (#443485) - Avoid possible test failures on non-english locales- New upstream release 6.11 - removed accepted patches + few minor patch changes- fix wrong checksum line handling in sha1sum -c command(#439531)- fix possible segfault in sha1sum/md5sum command- fix possible build-failure typo in i18n patch(#442205)- fix colorls.sh syntax with Zsh (#440652) - mention that cp -a includes -c option + mention cp -c option in manpages (#440056) - fix typo in runuser manpages (#439410)- better workaround of glibc getoptc change(factor test) - don't segfault mknod, mkfifo with invalid-selinux-context- keep LS_COLORS when USER_LS_COLORS defined - someupstream fixes: - mkdir -Z invalid-selinux-context dir no longer segfaults - ptx with odd number of backslashes no longer leads to buffer overflow - paste -d'\' file" no longer ovveruns memory- covered correct handling for some test conditions failures e.g. root build+selinux active and not running mcstrans(d) or selinux enforcing (#436717)- mv: never unlink a destination file before calling rename (upstream, #438076)- disable echo option separator behavior(added by #431005, request for removal #437653 + upstream) - temporarily disabled longoptions change until full clarification upstreamery (#431005)- fixed harmless double close of stdout in dd(#436368)- fixed broken order of params in stat(#435669)- colorls.csh missing doublequotes (#435789) - fixed possibility to localize verbose outputs- consolidation of verbose output to stdout (upstream)- use default security context in install - broken by coreutils-6.10 update(#319231) - some sh/csh scripts optimalizations(by ville.skytta@iki.fi, - #433189, #433190)- keep old csh/sh usermodified colorls shell scripts but use the new ones(#432154)- better 256-color support in colorls shell scripts - color tuning(based on feedback in #429121)- enabled 256-color support in colorls shell scripts(#429121) - fixed syntax error in csh script(#431315)- forgotten return in colorls.sh change- fix unability of echo to display certain strings(added -- separator, #431005) - do not rxXW8kGc$WGcFc XML_Parser, Net_Socket, Net_SMTP - snmp: disable MSHUTDOWN function to prevent error_log noise (#153988) - mysqli: add fix for crash on x86_64 (Georg Richter, upstream #32282)- build shared objects as PIC (#154195)- fix PEAR installation and bundle PEAR DB-1.7.5 package- update to 5.0.4 (#153068) - add .phps AddType to php.conf (#152973) - better gcc4 fix for libxmlrpc- BuildRequire mysql-devel >= 4.1 - don't mark php.ini as noreplace to make upgrades work (#152171) - fix subpackage descriptions (#152628) - fix memset(,,0) in Zend (thanks to Dave Jones) - fix various compiler warnings in Zend- package mysqli extension in php-mysql - really enable pcntl (#142903) - don't build with --enable-safe-mode (#148969) - use "Instant Client" libraries for oci8 module (Kai Bolay, #149873)- fix build with GCC 4- install the ext/gd headers (#145891) - enable pcntl extension in /usr/bin/php (#142903) - add libmbfl array arithmetic fix (dcb314@hotmail.com, #143795) - add BuildRequire for recent pcre-devel (#147448)- update to 5.0.3 (thanks to Robert Scheck et al, #143101) - enable xsl extension (#142174) - package both the xsl and dom extensions in php-xml - enable soap extension, shared (php-soap package) (#142901) - add patches from upstream 5.0 branch: * Zend_strtod.c compile fixes * correct php_sprintf return value usage- update for db4-4.3 (Robert Scheck, #140167) - build against mysql-devel - run tests in %check- truncate changelog at 4.3.1-1 - merge from 4.3.x package: - enable mime_magic extension and Require: file (#130276)- fix dom/sqlite enable/without confusion- fix phpize installation for lib64 platforms - add fix for segfault in variable parsing introduced in 5.0.2- update to 5.0.2 (#127980) - build against mysqlclient10-devel - use new RTLD_DEEPBIND to load extension modules - drop explicit requirement for elfutils-devel - use AddHandler in default conf.d/php.conf (#135664) - "fix" round() fudging for recent gcc on x86 - disable sqlite pending audit of warnings and subpackage split- don't build dom extension into 2.0 SAPI- ExclusiveArch: x86 ppc x86_64 for the moment- fix default extension_dir and conf.d/php.conf- update to 5.0.1 - only build shared modules once - put dom extension in php-dom subpackage again - move extension modules into %{_libdir}/php/modules - don't use --with-regex=system, it's ignored for the apache* SAPIs- Merge in some spec file changes from Jeff Stern (jastern@uci.edu)- bump to 5.0.0 - add patch to prevent clobbering struct re_registers from regex.h - remove domxml references, replaced with dom now built-in - fix php.ini to refer to php5 not php45.5.38-13.el7.remi5.5.38-13.el7.remigd.inigd.so/opt/remi/php55/root/etc/php.d//opt/remi/php55/root/usr/lib64/php/modules/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuhttps://forum.remirepo.net/?ldЎ;J]!LΈJ]NoGVbC NoGVScivQcq0Jrb)ƛB*J]!LΈJ]NoGVbC NoGV;yو>םBW*wX`y&\š 2b01ec8ca051e85c0bb5589066b40b4d08ba3682b dbnfig(libssl)mpkgconfig(libsepol) pkgconfig(libpng)\pkgconfig(libpcre)Glpkgconfig(liblzma)2-edpkgconfig(libevent)dlpkgconfig(libelf)pkgconfig(libcrypto) mpkgconfig(kdb)s.hlpkgconfig(kbproto) opkgconfig(icu-uc).pkgconfig(icu-le)vpkgconfig(icu-i18n)Dpkgconfig(gssrpc)pkgconfig(formw)mtpkgconfig(form)/H pkgconfig(apr-1)@p ADHI  $@ pkgconfigepinentryxXWV$FVWUis 2.0.6-1Tim Powers 2.0.5-4Elliot Lee 2.0.5-3Bernhard Rosenkraenzer 2.0.5-2Mike A. Harris 2.0.5-1Mike A. Harris 2.0.4-2Mike A. Harris 2.0.4-1Mike A. Harris 2.0.3-7Mike A. Harris 2.0.3-6Bernhard Rosenkraenzer 2.0.3-5Bernhard Rosenkraenzer 2.0.3-4Nalin Dahyabhai 2.0.3-3Mike A. Harris 2.0.3-2Mike A. Harris 2.0.3-1Bill Nottingham Bernhard Rosenkraenzer Nalin Dahyabhai Bernhard Rosenkraenzer Bernhard Rosenkraenzer Prospector Preston Brown Preston Brown Nalin Dahyabhai Cristian Gafton Preston Brown Bernhard Rosenkraenzer Preston Brown Preston Brown Preston Brown Cristian Gafton Cristian Gafton Preston Brown Preston Brown Preston Brown Cristian Gafton Preston Brown Preston Brown - Test bitmap size earlier for PNGs - Fix memory leak in pngshim.c - Resolves: #1891635- Fix rendering in monochrome mode - Resolves: #1657479- Fix definition of constant ft_encoding_gb2312 in freetype.h - Resolves: #1645218- Fix loading of avar tables - Resolves: #1576504- Preserve API/ABI compatibility for public symbols - Resolves: #1576504- Update to 2.8 - Resolves: #1576504- Fix shellcheck warning (coverity) - Related: #1368141- Backport functions for reading signed values from stream - Resolves: #1381678- Don't show path of non-existing libtool file - Resolves: #1368141- Define _FILE_OFFSET_BITS=64 to handle inodes higher than or equal to 2^31 - Resolves: #1303268- Fixes CVE-2014-9657 - Check minimum size of `record_size'. - Fixes CVE-2014-9658 - Use correct value for minimum table length test. - Fixes CVE-2014-9675 - New macro that checks one character more than `strncmp'. - Fixes CVE-2014-9660 - Check `_BDF_GLYPH_BITS'. - Fixes CVE-2014-9661 - Initialize `face->ttf_size'. - Always set `face->ttf_size' directly. - Exclusively use the `truetype' font driver for loading the font contained in the `sfnts' array. - Fixes CVE-2014-9663 - Fix order of validity tests. - Fixes CVE-2014-9664 - Add another boundary testing. - Fix boundary testing. - Fixes CVE-2014-9667 - Protect against addition overflow. - Fixes CVE-2014-9669 - Protect against overflow in additions and multiplications. - Fixes CVE-2014-9670 - Add sanity checks for row and column values. - Fixes CVE-2014-9671 - Check `size' and `offset' values. - Fixes CVE-2014-9673 - Fix integer overflow by a broken POST table in resource-fork. - Fixes CVE-2014-9674 - Fix integer overflow by a broken POST table in resource-fork. - Additional overflow check in the summation of POST fragment lengths. - Work around behaviour of X11's `pcfWriteFont' and `pcfReadFont' functions - Resolves: #1197740- Generic 32/64 bit platform detection (fix ppc64le build) - Resolves: #1126099- Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- Fix vertical size of emboldened glyphs - Resolves: #1010341- Add aarch64 to 64 bit arch list- Change encoding of "docs/tutorial/example3.cpp" to UTF-8- Package ftconfig.h as source file- Fix emboldening: - split out MSB function - fix integer overflows - fix broken emboldening at small sizes - Resolves: #891457- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Update to 2.4.11 - Resolves: #889177- Update License field- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Update to 2.4.10 - Remove patches whicx' (  '  X UȦZProvidename@x@XdW`.w$gwxv- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rediff systzdata patch- update to v6 of systzdata patch; various fixes- update to v5 of systzdata patch; parses zone.tab and extracts timezone->{country-code,long/lat,comment} mapping table- update to 5.3.0 - remove ncurses, dbase, mhash extensions - add enchant, sqlite3, intl, phar, fileinfo extensions - raise sqlite version to 3.6.0 (for sqlite3, build with --enable-load-extension) - sync with upstream "production" php.ini- update to 5.2.10 - add interbase sub-package- update to 5.2.9- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add recode support, -recode subpackage (#106755) - add -zts subpackage with ZTS-enabled build of httpd SAPI - adjust php.conf to use -zts SAPI build for worker MPM- fix patch fuzz, renumber patches- drop obsolete configure args - drop -odbc patch (#483690)- split out sysvshm, sysvsem, sysvmsg, posix into php-process- move wddx to php-xml, build curl shared in -common - remove BR for expat-devel, bogus configure option- rebuild for new MySQL- libtool 2 workaround for phpize (#476004) - add missing php_embed.h (#457777)- update to 5.2.8- libtool 2 workaround- update to 5.2.7 - enable pdo_dblib driver in php-mssql- tweak Summary, thanks to Richard Hughes- move gd_README to php-gd - update to r4 of systzdata patch; introduces a default timezone name of "System/Localtime", which uses /etc/localtime (#469532)- enable XPM support in php-gd - Fix BR for php-gd- enable T1lib support in php-gd- update to 5.2.6 - sync default php.ini with upstream - drop extension_dir from default php.ini, rely on hard-coded default, to make php-common multilib-safe (#455091) - update to r3 of systzdata patch- split pspell extension out into php-spell (#443857)- Autorebuild for GCC 4.3- ext/date: use system timezone database- rebuild for libc-client bump- Rebuild for openssl bump- update to 5.2.5- correct pcre BR version (#333021) - restore metaphone fix (#205714) - add READMEs to php-cli- update to 5.2.4- rebuild for fixed APR- add ldconfig post/postun for -embedded (Hans de Goede)- add php-embedded sub-package- fix build with new glibc - fix License- define php_extdir in macros.php- obsolete php-dbase- add mcrypt, mhash, tidy, mssql subpackages (Dmitry Butskoy) - enable dbase extension and package in -common- update to 5.2.3 (thanks to Jeff Sheltren)- fix php-pdo *_arg_force_ref global symbol abuse (#216125)- rebuild against uw-imap-devel- update to 5.2.2 - synch changes from upstream recommended php.ini- enable SASL support in LDAP extension (#205772)- drop mime_magic extension (deprecated by php-pecl-Fileinfo)- fix regression in str_{i,}replace (from upstream)- update to 5.2.1 - add Requires(pre) for httpd - trim %changelog to versions >= 5.0.0- bump default memory_limit to 32M (#220821) - mark config files noreplace again (#174251) - drop trailing dots from Summary fields - use standard BuildRoot - drop libtool15 patch (#226294)- add php(api), php(zend-abi) provides (#221302) - package /usr/share/php and append to default include_path (#225434)- fix filter.h installation path - fix php-zend-abi version (Remi Collet, #212804)- rebuild again- rebuild for net-snmp soname bump- build json and zip shared, in -common (Remi Collet, #215966) - obsolete php-json and php-pecl-zip - build readline extension into /usr/bin/php* (#210585) - change module subpackages to require php-common not php (#177821)- provide php-zend-abi (#212804) - add /etc/rpm/macros.php exporting interface versions - synch with upstream recommended php.ini- update to 5.2.0 (#213837) - php-xml provides php-domxml (#215656) - fix php-pdo-abi provide (#214281)- rebuild for curl soname bump - add build fix for curl 7.16 API- from upstream: add safety checks against integer overflow in _ecalloc- update to 5.1.6 (security fixes) - bump default memory_limit to 16M (#196802)- rebuild- Provide php-posix (#194583) - only provide php-pcntl from -cli subpackagexXXءx$Ip* %LG #Rm&·DPdJ@ {Fҵ/v%g$(-T!r\lLlAMZM&-(g > p:zhP6xZ1VdP`xE-?1I#f8v2p~J߷z,Gށ)0dS[$4뷕$^d!7]xN;ТR'}DG }"J;=,X*o T^X" z:HVw^ /,ѳLma '~vwJ]_ i$ƨ9> ݊`>EcV.'9OpA/.^{q!7CkPzi oj*Hg繅C7 `_v8LeblTJqnHAsRY7D;T#ӂ4%gZA`H(O:H[3'd;pK'I>1j\NjCLkAYZqPBB>(_^pcJ*wmJVk `)g{8e du ^#Un{or*S&9|+컫zrF'" 5TFI6~q͂BII=R%3dqD"<ÑqT'ɑt3nv 9amsE1q70F퓛j2SLt} yei5mB M:C8|YgdQƏXaqO>VșKJwhQb55bd8f133c6e0403d52a341d44a6de408b4c087b*bper xfsprogs (Brian Foster) [1579873] - [fs] libxfs: clean up _dir2_data_freescan (Brian Foster) [1579873] - [fs] libxfs: fix xfs_attr_shortform_bytesfit declaration (Brian Foster) [1579873] - [fs] libxfs: fix whitespace problems (Brian Foster) [1579873] - [fs] libxfs: synchronize dinode_verify with userspace (Brian Foster) [1579873] - [fs] libxfs: convert ushort to unsigned short (Brian Foster) [1579873] - [fs] xfs: rmap btree requires more reserved free space (Brian Foster) [1579873] - [fs] cifs: avoid a kmalloc in smb2_send_recv/SendReceive2 for the common case (Leif Sahlberg) [1582973] - [fs] cifs: remove small_smb2_init (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2_lease_ack (Leif Sahlberg) [1582973] - [fs] cifs: remove unused variable from SMB2_read (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2_oplock_break we get from server (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2_query_info_req (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2_query_directory_req (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2_set_info_req (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2 read/write requests (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2_lock_req (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2_flush_req (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2_create_req (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2_sess_setup_req (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2_tree_connect_req (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2_echo_req (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2_ioctl_req (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2_close_req (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2_tree_disconnect_req (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2_logoff_req (Leif Sahlberg) [1582973] - [fs] cifs: remove rfc1002 header from smb2_negotiate_req (Leif Sahlberg) [1582973] - [fs] cifs: Add smb2_send_recv (Leif Sahlberg) [1582973]- [target] iscsi: avoid NULL dereference in CHAP auth error path (Maurizio Lombardi) [1585081] - [iscsi-target] Fix non-immediate TMR reference leak (Maurizio Lombardi) [1585081] - [iscsi-target] Make TASK_REASSIGN use proper se_cmd->cmd_kref (Maurizio Lombardi) [1585081] - [target] Avoid early CMD_T_PRE_EXECUTE failures during ABORT_TASK (Maurizio Lombardi) [1585081] - [target] Fix quiese during transport_write_pending_qf endless loop (Maurizio Lombardi) [1585081] - [target] Fix caw_sem leak in transport_generic_request_failure (Maurizio Lombardi) [1585081] - [target] Fix QUEUE_FULL + SCSI task attribute handling (Maurizio Lombardi) [1585081] - [iSCSI-target] Use common error hxpX^`ؐi$@iii !""$%%'()*++-..0113446779::<==?@@BCCEFFHIIKLLNOOQRSTUVW1.11.0-1.el71.11.0-1.el71.11.0-1.el71.11.0-1.el7 certbot_apachecertbot_apache-1.11.0-py2.7.egg-infoPKG-INFOSOURCES.txtdependency_links.txtentry_points.txtrequires.txttop_level.txt__init__.py__init__.pyc__init__.pyo_internal__init__.py__init__.pyc__init__.pyoapache_util.pyapache_util.pycapache_util.pyoapacheparser.pyapacheparser.pycapacheparser.pyoassertions.pyassertions.pycassertions.pyoaugeas_lenshttpd.augaugeasparser.pyaugeasparser.pycaugeasparser.pyoconfigurator.pyconfigurator.pycconfigurator.pyoconstants.pyconstants.pycconstants.pyodisplay_ops.pydisplay_ops.pycdisplay_ops.pyodualparser.pydualparser.pycdualparser.pyoentrypoint.pyentrypoint.pycentrypoint.pyohttp_01.pyhttp_01.pychttp_01.pyointerfaces.pyinterfaces.pycinterfaces.pyoobj.pyobj.pycobj.pyooverride_arch.pyoverride_arch.pycoverride_arch.pyooverride_centos.pyoverride_centos.pycoverride_centos.pyooverride_darwin.pyoverride_darwin.pycoverride_darwin.pyooverride_debian.pyoverride_debian.pycoverride_debian.pyooverride_fedora.pyoverride_fedora.pycoverride_fedora.pyooverride_gentoo.pyoverride_gentoo.pycoverride_gentoo.pyooverride_suse.pyoverride_suse.pycoverride_suse.pyoparser.pyparser.pycparser.pyoparsernode_util.pyparsernode_util.pycparsernode_util.pyotls_configscurrent-options-ssl-apache.confold-options-ssl-apache.confpython2-certbot-apache-1.11.0README.rstpython2-certbot-apache-1.11.0LICENSE.txt/usr/lib/python2.7/site-packages//usr/lib/python2.7/site-packages/certbot_apache-1.11.0-py2.7.egg-info//usr/lib/python2.7/site-packages/certbot_apache//usr/lib/python2.7/site-packages/certbot_apache/_internal//usr/lib/python2.7/site-packages/certbot_apache/_internal/augeas_lens//usr/lib/python2.7/site-packages/certbot_apache/_internal/tls_configs//usr/share/doc//usr/share/doc/python2-certbot-apache-1.11.0//usr/share/licenses//usr/share/licenses/python2-certbot-apache-1.11.0/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnudirectoryASCII textPython script, ASCII text executablepython 2.7 byte-compiled xXgV(%X$9 directoryUTF-8 Unicode textASCII textPerl script, ASCII text executabletroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)Perl5 module source textPerl POD document, ASCII textC++ source, ASCII textHTML document, ASCII text #'.6;@ENW^c PRRRPRRPRR RRPRRRRRRPRRRRRRPRRRRPRRRPRRRPRRR R RRP RRRRRRRP R RRRP R RRRP R RRRP PRR R RRRRPPRR R RRRRPPR R RRRPRR RRPRRRRR?HS+$ƨpM8B*_BBVȀdGp܄AD+Qц=S+zXK~A5Ul:l88g>ʺ&MXi\ :p+ XKp"gX0P9)_9^CkwdIY%YX"be%HYUmε JGt aTTR9qc]L|]=fe_՜LZg;/`/1Q̃Z֕ $o"BJӬCS{XA(UMEѳ6ȥ4۹%OV/dٝCFRWW*Ku%=n b lrЯ`i6$Z%m3A} Ȧ=Z!T#z2CrdZ,#y {蝣6d>j+dQy1Iljn¨7^?I_V)D ΐpB>S+$ƨz{d}#vE%ΫAhk[? VCuκshF=Me﹗Dq=J2vX(ƒ+pr 90n *t[Lcwi0v=aF2Lѷom2 3+$TMg$狡٤DŽ5X R&g d ∂51CȍG~^zh9L^-SFW3"d\W"̙㫏T_Rt̕wEz8O'b;u{^c{:"c$>DZx/lB4"ۭNMIt#t !uOZnzaY]TӨlD{u#ib CVr@~ OUҴv=kQDՔwokpr[M$-:3.g`f~U %=wCpEh+PX/bW@o vpϾ舘 >Vڣ;|٦uRde9bdc5c937255c2c4b68135801ccb0a90f9bb02b!8lb49 1346472 1347091 1359806] - [lib] list: kill list_force_poison() (Jeff Moyer) [1346083 1346084 1346445 1346449 1346472 1347091 1359806] - [acpi] nfit: Continue init even if ARS commands are unimplemented (Jeff Moyer) [1346083 1346084 1346445 1346449 1346472 1347091 1359806] - [fs] ext2, ext4: fix issue with missing journal entry in ext4_dax_mkwrite() (Jeff Moyer) [1346083 1346084 1346445 1346449 1346472 1347091 1359806] - [mm] dax: move writeback calls into the filesystems (Jeff Moyer) [1346083 1346084 1346445 1346449 1346472 1347091 1359806] - [kernel] dax: give DAX clearing code correct bdev (Jeff Moyer) [1346083 1346084 1346445 1346449 1346472 1347091 1359806] - [fs] ext4: online defrag not supported with DAX (Jeff Moyer) [1346083 1346084 1346445 1346449 1346472 1347091 1359806] - [fs] ext2, ext4: only set S_DAX for regular inodes (Jeff Moyer) [1346083 1346084 1346445 1346449 1346472 1347091 1359806] - [fs] block: disable block device DAX by default (Jeff Moyer) [1346083 1346084 1346445 1346449 1346472 1347091 1359806] - [nvdimm] use 'u64' for pfn flags (Jeff Moyer) [1346083 1346084 1346445 1346449 1346472 1347091 1359806] - [kernel] devm_memremap: Fix error value when memremap failed (Jeff Moyer) [1346083 1346084 1346445 1346449 1346472 1347091 1359806] - [uapi] nx`XdV([$<bc157386fde7cc8f4949a49c4374a88735cdd6b9e7b6e887892b2ff7b111bcc1d812abc27afcebc3ea243bd60a0c834aa813556fb2fa64361f54e06a8f0939229a9d204671230a3d59153c227d99330f01c2a47afa31585c889a63a2eb7c99f7d38e789745c4ee2002a44cc43e41aa8492587323f249dfbe8a21414624316a619f57e78866902397be7292957624e548676176f9abbca379b42856f0f506cdea128508ba598b364b50651f6fb665551bd306d4ab5eb736708929eb1d635db6b17230c391e816bdfe6839883a5e3e1aba761c386086d4502661a1b11faa6f8ce6577f55d4d6ee1d64236f178395de2d266883c645c451dc4220d10646db0b45aecc873ec0d09ce9e5454f08ee1f282b4173302b9ec6e29fee78eeaeb789a84e9bd92aa2c41085c2143cd42178273236bea0be3a476fbb619bd83737f61e2c2c0710deec31fdb1306dcebe942683682cdd6975e5c06906d6c41748866bfd20cb4f5cbc5acd4709aedd06722b91aa58e8ced4cdba535e87c721721997735c20bd96e201f525a17a76c5cce0dec974bfcedaac74b535ca4d39e594bba06e8790fd37bfee24ed5ecd4fcc67b1dbf213e13308fd70a43de90120f48d23b4f52e5484fbd2c1bb58051db47e32de5766ce63895da40c0558f58985f94562e783d0db9009e75ff70f1cc6f2253c225b1a7d2de287fbcd626ac155c643d1f56b0a3c4a9cc7a73fc723a5ffdd6127a92cd7d156fd64fd8961f1ffe9d2350b76e5c76069e0bb67a118cf59007206b358929f91e67rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootperl-MailTools-2.12-2.el7.src.rpmperl(Mail::Address)perl(Mail::Cap)perl(Mail::Field)perl(Mail::Field::AddrList)perl(Mail::Field::Date)perl(Mail::Field::Generic)perl(Mail::Filter)perl(Mail::Header)perl(Mail::Internet)perl(Mail::Mailer)perl(Mail::Mailer::qmail)perl(Mail::Mailer::rfc822)perl(Mail::Mailer::sendmail)perl(Mail::Mailer::smtp)perl(Mail::Mailer::smtp::pipe)perl(Mail::Mailer::smtps)perl(Mail::Mailer::smtps::pipe)perl(Mail::Mailer::testfile)perl(Mail::Mailer::testfile::pipe)perl(Mail::Send)perl(Mail::Util)perl-MailTools@@@@@@@@@@@@@@@@@@@    perl(:MODULE_COMPAT_5.16.3)perl(Carp)perl(Config)perl(Date::Format)perl(Date::Parse)perl(Exporter)perl(IO::Handle)perl(Mail::Address)perl(Mail::Field)perl(Mail::Field::Generic)perl(Mail::Header)perl(Mail::Mailer)perl(Mail::Mailer::rfc822)perl(Mail::Util)perl(Net::SMTP)perl(Net::SMTP::SSL)perl(POSIX)perl(base)perl(strict)perl(vars)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.1RkR6PO@P>@P

>_Daniel Mach - 2.12-2Petr Šabata - 2.12-1.1Paul Howarth 2.12-1Paul Howarth 2.11-1Paul Howarth 2.10-1Fedora Release Engineering - 2.09-3Petr Pisar - 2.09-2Paul Howarth - 2.09-1Paul Howarth - 2.08-3Marcela Mašláňová - 2.08-2Paul Howarth - 2.08-1Fedora Release Engineering - 2.07x؅XfV`$:files list- Rebuild against perl 5.10.1- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Update to 2.04- Update to 2.03- Rebuild for perl 5.10 (again)- rebuild for new perl- Update to 2.02 - Remove buildreqs perl(Net::SMTP) and perl(Net::Domain), bundled with perl - Add buildreqs perl(Date::Format), perl(Date::Parse), perl(Test::More), and perl(Test::Pod) - Remove patch for CPAN RT#20726, now fixed upstream - Buildreq perl >= 5.8.1 - Tweak files list to mark pod files as %doc - Fix character encoding for ChangeLog- Clarify license as GPL v1 or later, or Artistic (same as perl) - Unexpand tabs in spec file- Update to 1.77- Update to 1.76 - Add comment text about the patch for fixing CPAN RT#20726 - BuildRequire perl(ExtUtils::MakeMaker) rather than perl-devel- Buildrequire perl-devel for Fedora 7 onwards - Fix argument order for find with -depth- FE6 mass rebuild- cosmetic spec file changes - fix CPAN RT#20726 (RH #200450), allowing Mail::Util::read_mbox() to open files with weird names- 1.74.- 1.73.- 1.72.- 1.71.- Fix demo scripts. - Sync with fedora-rpmdevtools' perl spec template.- update to 1.67 (#161830) - assume perl_vendorlib is set - license is same as perl (GPL or Artistic) according to README - don't include module name in summary - use macros consistently - add dist tag- rebuilt- Update to 1.66.- Update to 1.64, patch applied upstream. - Bring up to date with current fedora.us Perl spec template.- Add patch to complete test.pm -> testfile.pm change introduced in 1.61.- Update to 1.61. - Reduce directory ownership bloat. - Run tests in the %check section.- Update to 1.60. - Install into vendor dirs. - Spec cleanups.- Package is now noarch- Changed group tag - Making test in build section- Modified files section- Added forgotten description - Modified Summary according to Michael Schwendt suggestion - Modified tarball permissions to 0644- Initial build.  !"#$%&'()*+,-./01234562.122.122.122.122.122.122.122.122.122.122.122.122.122.122.122.122.122.122.122.122.122.12-2.el7perl-MailTools-2.12ChangeLogREADMEREADME.demosexamplesforwd_demomail-mailer.plrplyto_demosend_demoMail::Address.3pm.gzMail::Cap.3pm.gzMail::Field.3pm.gzMail::Field::AddrList.3pm.gzMail::Field::Date.3pm.gzMail::Field::Generic.3pm.gzMail::Filter.3pm.gzMail::Header.3pm.gzMail::Internet.3pm.gzMail::Mailer.3pm.gzMail::Send.3pm.gzMail::Util.3pm.gzMailAddress.pmAddress.podCap.pmCap.podFieldField.pmField.podAddrList.pmAddrList.podDate.pmDate.podGeneric.pmGeneric.podFilter.pmFilter.podHeader.pmHeader.podInternet.pmInternet.podMailerMailer.pmMailer.podqmail.pmrfc822.pmsendmail.pmsmtp.pmsmtps.pmtestfile.pmSend.pmSend.podUtil.pmUtil.pod/usr/share/doc//usr/share/doc/perl-MailTools-2.12//usr/share/doc/perl-MailTools-2.12/examples//usr/share/man/man3//usr/share/perl5/vendor_perl//usr/share/perl5/vendor_perl/Mail//usr/share/perl5/vendor_perl/Mail/Field//usr/share/perl5/vendor_perl/Mail/Mailer/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2noarch-redhat-linux-gnuxPuX\VFG$VFGGG8ases in initscript before starting- rebuild to cope with glibc locale binary incompatibility- move initscript back- automatic rebuild- /etc/rc.d/init.d -> /etc/init.d - fix /var/state/dhcp -> /var/lib/dhcp- condrestart for initscript, graceful upgrades.- gzipped man pages - marked /etc/rc.d/init.d/dhcp as a config file- fix booting of JavaStations (reported by Pete Zaitcev ). - fix SIGBUS crashes on SPARC (apparently gcc is too clever).- chkconfig --del in %preun, not %postun- initscript munging- update to 2.0.- don't run by default- update to 2.0b1pl28.- strip binaries- copy the source file in prep, not move- auto rebuild in the new build environment (release 4)- added a sample dhcpd.conf file - we don't need to dump rfc's in /usr/doc- modify dhcpd.init to exit if /etc/dhcpd.conf is not present- Upgraded to 2.0b1pl6 (patch1 no longer needed).- applied patch from Chris Evans which makes the server a bit more paranoid about dhcp requests coming in from the wire- updated to dhcp 2.0b1pl1 - got proper man pages in the package- updated to build in a buildroot properly - don't package up the client, as it doens't work very well - Build rooted and corrected file listing.- removed the actual inet.d links (chkconfig takes care of this for us) and made the %postun section handle upgrades.- First package. 12:4.2.5-83.el7.centos.212:4.2.5-83.el7.centos.2 NetworkManagerdispatcher.d11-dhclientdhclient-exit-hooks.dazure-cloud.shdhclient.d56dhclientdhclientdhclient-scriptdhclient-4.2.5README.dhclient.ddhclient.conf.exampledhclient6.conf.exampledhclient.conf.5.gzdhclient.leases.5.gzdhclient-script.8.gzdhclient.8.gzdhclient/etc//etc/NetworkManager//etc/NetworkManager/dispatcher.d//etc/dhcp//etc/dhcp/dhclient-exit-hooks.d//usr/lib64/pm-utils/sleep.d//usr/sbin//usr/share/doc//usr/share/doc/dhclient-4.2.5//usr/share/man/man5//usr/share/man/man8//var/lib/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnu?sXfi $ƨ,XD$6齳j 6E>IGJr{Rf?/WHmљ3k}Q1IJid5RU>cOC˳"myوl7!%*0?OҐ׹7mh9IkEpnTiqClDQqIJ{:!,1e/20C! |JN*Wr>:Rgӛ ujmN_M $|aHq0h*1D_Kѻq:Er׷-aY@hjr+jL5=o=Gj 5p'/tkkf:sS-sNEy961Q^p%xfi $ƨF ӡ[qF'.fdo&3*غ3uZ?KoşLnm-3Uke%|bN,Ki@qŵem!V6 ,?HD4h.ĺ"Gl0z"D ݷƵ^wXTaf$n ,qLV]oEDreply_post_host_index as __iomem (Tomas Henzl) [1088524] - [scsi] mpt2sas: combine fw_event_work and its event_data (Tomas Henzl) [1088524] - [scsi] mpt2sas: correct scsi_(target, device) hostdata allocation (Tomas Henzl) [1088524] - [scsi] mpt2sas: Don't disable device twice at suspend (Tomas Henzl) [1088524]- [scsi] lpfc: driver release 10.2.8021.1 for RHEL7 (Rob Evers) [1149846] - [scsi] lpfc: 10.4.8000.0: Fixed crash from page fault caused by use after rport delete (Rob Evers) [1149846] - [scsi] lpfc: 10.4.8000.0: Fix locking issues with abort data paths (Rob Evers) [1149846] - [scsi] lpfc: 10.4.8000.0: Fix race between LOGO/PLOGI handling causing NULL pointer (Rob Evers) [1149846] - [scsi] lpfc: 10.4.8000.0: Fix IP Reset processing - wait for RDY before proceeding (Rob Evers) [1149846] - [scsi] lpfc: 10.4.8000.0: Fix quarantined XRI recovery qualifier state in link bounce (Rob Evers) [1149846] - [scsi] lpfc: 10.4.8000.0: Fix discovery timeout during nameserver login (Rob Evers) [1149846] - [net] ipv6: mld: answer mldv2 queries with mldv1 reports in mldv1 fallback (Daniel Borkmann) [1143429] - [net] team: avoid race condition in scheduling delayed work (Jiri Pirko) [1149239] - [net] fix UDP tunnel GSO of frag_list GRO packets (Jiri Benc) [1119392] - [net] vxlan: fix incorrect initializer in union vxlan_addr (Daniel Borkmann) [1130643] - [net] vxlan: fix crash when interface is created with no group (Daniel Borkmann) [1130643] - [net] vxlan: fix nonfunctional neigh_reduce() (Daniel Borkmann) [1130643] - [net] vxlan: fix potential NULL dereference in arp_reduce() (Daniel Borkmann) [1130643] - [net] vxlan: remove unused port variable in vxlan_udp_encap_recv() (Daniel Borkmann) [1130643] - [net] vxlan: remove extra newline after function definition (Daniel Borkmann) [1130643]- [kernel] workqueue: Add quiescent state between work items (Jiri Pirko) [1149250] - [crypto] qat: Enable interrupts from all 32 bundles (Nikolay Aleksandrov) [1091130] - [char] ipmi: Clear drvdata when interface is removed (Tony Camuso) [1136589] - [md] raid5: disable 'DISCARD' by default due to safety concerns (Jes Sorensen) [1149931] - [md] raid1: fix_read_error should act on all non-faulty devices (Jes Sorensen) [1149931] - [virt] hyperv: NULL dereference on error (Jason Wang) [1146357] - [virt] hyperv: Increase the buffer length for netvsc_channel_cb() (Jason Wang) [1146357] - [virt] hyperv: Adjust the size of sendbuf region to support ws2008r2 (Jason Wang) [1146357] - [virt] hyperv/net: Increase the size of the sendbuf region (Jason Wang) [1146357] - [virt] hyperv: Fix error return code in netvsc_init_buf() (Jason Wang) [1146357] - [virt] hyperv: Add netpoll support (Jason Wang) [1146357] - [virt] hyperv/net: remove unnecessary null test before kfree (Jason Wang) [1146357] - [virt] hyperv: Add handler for RNDIS_STATUS_NETWORK_CHANGE event (Jason Wang) [1146357] - [virt] hyperv: fix apparent cut-n-paste error in send path teardown (Jason Wang) [1146357] - [virt] hyperv: Add hash value into RNDIS Per-packet info (Jason Wang) [1146357] - [virt] hyperv/net: Add support for netvsc build without CONFIG_SYSFS flag (Jason Wang) [1146357] - [virt] hyperv: Properly handle checksum offload (Jason Wang) [1146357] - [virt] hyperv: Enable sendbuf mechanism on the send path (Jason Wang) [1146357] - [virt] hyperv: Simplify the send_completion variables (Jason Wang) [1146357] - [virt] hyperv: Remove recv_pkt_list and lock (Jason Wang) [1146357] - [virt] hyperv: Add support for virtual Receive Side Scaling (vRSS) (Jason Wang) [1146357] - [virt] hyperv/net: Address UDP checksum issues (Jason Wang) [1146357] - [virt] hyperv/net: Negotiate suitable ndis version for offload support (Jason Wang) [1146357] - [virt] hyperv/net: Allocate memory for all possible per-pecket information (Jason Wang) [1146357] - [virt] hyperv/net: Enable large sex03X6X`:$m>Joerg Bruehe Kent Boortz Kristian Nielsen Kent Boortz Rodrigo Novo Joerg Bruehe Joerg Bruehe Lenz Grimmer Kent Boortz Kent Boortz Kent Boortz Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Joerg Bruehe Guilhem Bichot Lenz Grimmer Lenz Grimmer Petr Chardin Lenz Grimmer Lenz Grimmer Petr Chardin Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer Lenz Grimmer MontyMontyMontyTim Smith David Axmark David Axmark David Axmark David Axmark David Axmark David Axmark - Add License Book, remove COPYING- Add perl modules for test subpackage- No longer need to remove obsoleted mysqltest man pages- Add keyring_encrypted_file.so plugin- Remove obsoleted mysqltest man pages- Add keyring_aws.so plugin to commercial server subpackage- Add connection_control.so to server subpackage- Updated compatver to 5.6.31 - Adapt MySQL server 5.7 packaging to MySQL Cluster 7.5 - Remove mysql_config from client subpackage- Add test_udf_services.so plugin - Add keyring_udf.so plugin to server subpackage- Add keyring_okv.so plugin to commercial server subpackage- Include mysql-keyring directory - Provide keyring_file.so plugin- Included man pages for lz4_decompress and zlib_decompress- Added lines to remove man pages we are not ready to include yet- Added new decompression utilities lz4_decompress and zlib_decompress binaries to client subpackage.- Added mysqlx.so- Updated for 5.7.9 - Added libtest_* plugins to test subpackage - Add mysqlpump man page - Obsolete mysql-connector-c-shared dependencies- Add support for pkg-config- Added libtest_framework.so, libtest_services.so, libtest_services_threaded.so plugins - Build and ship mecab plugin- Include boost sources - Fix cmake buildrequires - Fix build on el5 with gcc44 - Add license info in each subpackage - Soname bump, more compat packages - Updated default shell for mysql user - Added mysql_ssl_rsa_setup - Include mysql-files directory- Provide replication_observers_example_plugin.so plugin- Updated for 5.7.6- Provide mysql_no_login.so plugin- Provide mysql-compat-server dependencies- Remove perl(GD) and dtrace dependencies- Resolve embedded-devel conflict issue- Add bench package - Enable dtrace- Updated for 5.7.5- Fix Cflags for el7- Support for enterprise packages - Upgrade from MySQL-* packages- Resolve conflict with mysql-libs-compat- Resolve conflict issues during upgrade - Add ha_example.so plugin which is now included- 5.7.4 - Enable shared libmysqld by cmake option - Move mysqltest and test plugins to test subpackage- Fixed isa_bits error- Initial 5.7 port- Fixed uln advanced rpm libyassl.a error - Updated to 5.6.15- Fixed mysql_install_db usage - Improved handling of plugin directory- Refresh mysql-instx"XW2$,L 154195)- fix PEAR installation and bundle PEAR DB-1.7.5 package- update to 5.0.4 (#153068) - add .phps AddType to php.conf (#152973) - better gcc4 fix for libxmlrpc- BuildRequire mysql-devel >= 4.1 - don't mark php.ini as noreplace to make upgrades work (#152171) - fix subpackage descriptions (#152628) - fix memset(,,0) in Zend (thanks to Dave Jones) - fix various compiler warnings in Zend- package mysqli extension in php-mysql - really enable pcntl (#142903) - don't build with --enable-safe-mode (#148969) - use "Instant Client" libraries for oci8 module (Kai Bolay, #149873)- fix build with GCC 4- install the ext/gd headers (#145891) - enable pcntl extension in /usr/bin/php (#142903) - add libmbfl array arithmetic fix (dcb314@hotmail.com, #143795) - add BuildRequire for recent pcre-devel (#147448)- update to 5.0.3 (thanks to Robert Scheck et al, #143101) - enable xsl extension (#142174) - package both the xsl and dom extensions in php-xml - enable soap extension, shared (php-soap package) (#142901) - add patches from upstream 5.0 branch: * Zend_strtod.c compile fixes * correct php_sprintf return value usage- update for db4-4.3 (Robert Scheck, #140167) - build against mysql-devel - run tests in %check- truncate changelog at 4.3.1-1 - merge from 4.3.x package: - enable mime_magic extension and Require: file (#130276)- fix dom/sqlite enable/without confusion- fix phpize installation for lib64 platforms - add fix for segfault in variable parsing introduced in 5.0.2- update to 5.0.2 (#127980) - build against mysqlclient10-devel - use new RTLD_DEEPBIND to load extension modules - drop explicit requirement for elfutils-devel - use AddHandler in default conf.d/php.conf (#135664) - "fix" round() fudging for recent gcc on x86 - disable sqlite pending audit of warnings and subpackage split- don't build dom extension into 2.0 SAPI- ExclusiveArch: x86 ppc x86_64 for the moment- fix default extension_dir and conf.d/php.conf- update to 5.0.1 - only build shared modules once - put dom extension in php-dom subpackage again - move extension modules into %{_libdir}/php/modules - don't use --with-regex=system, it's ignored for the apache* SAPIs- Merge in some spec file changes from Jeff Stern (jastern@uci.edu)- bump to 5.0.0 - add patch to prevent clobbering struct re_registers from regex.h - remove domxml references, replaced with dom now built-in - fix php.ini to refer to php5 not php48.0.30-6.el7.remi8.0.30-6.el7.remi20-imap.iniimap.so/etc/opt/remi/php80/php.d//opt/remi/php80/root/usr/lib64/php/modules/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuhttps://forum.remirepo.net/? - 7.0.33-39Remi Collet - 7.0.33-38Remi Collet - 7.0.33-37Remi Collet - 7.0.33-36Remi Collet - 7.0.33-35Remi Collet - 7.0.33-33Remi Collet - 7.0.33-32Remi Collet - 7.0.33-31Remi Collet - 7.0.33-29Remi Collet - 7.0.33-28Remi Collet - 7.0.33-26Remi Collet - 7.0.33-25Remi Collet - 7.0.33-24Remi Collet - 7.0.33-23Remi Collet - 7.0.33-22Remi Collet - 7.0.33-21Remi Collet - 7.0.33-20Remi Collet - 7.0.33-19Remi Collet - 7.0.33-18Remi Collet - 7.0.33-17Remi Collet - 7.0.33-15Remi Collet - 7.0.33-14Remi Collet - 7.0.33-13Remi Collet - 7.0.33-12Remi Collet - 7.0.33-11Remi Collet - 7.0.33-9Remi Collet - 7.0.33-8Remi Collet - 7.0.33-7Remi Collet - 7.0.33-6Remi Collet - 7.0.33-5Remi Collet - 7.0.33-4Remi Collet - 7.0.33-2Remi Collet - 7.0.33-1Remi Collet - 7.0.32-1Remi Collet - 7.0.31-1Remi Collet - 7.0.30-1Remi Collet - 7.0.29-1Remi Collet - 7.0.28-1Remi Collet - 7.0.27-1Remi Collet - 7.0.27~RC1-1Remi Collet - 7.0.26-1Remi Collet - 7.0.26~RC1-1Remi Collet - 7.0.25-1Remi Collet - 7.0.25~RC1-1Remi Collet - 7.0.24-1Remi Collet - 7.0.24~RC1-2Remi Collet - 7.0.24~RC1-1Remi Collet - 7.0.23-2Remi Collet - 7.0.23-1Remi Collet - 7.0.23~RC1-1Remi Collet - 7.0.22-2Remi Collet - 7.0.22-1Remi Collet - 7.0.22~RC1-1Remi Collet - 7.0.21-1Remi Collet - 7.0.21~RC1-1Remi Collet - 7.0.20-1Remi Collet - 7.0.20~RC1-1Remi Collet - 7.0.19-1Remi Collet - 7.0.19~RC1-2Remi Collet - 7.0.19~RC1-1Remi Collet - 7.0.18-1Remi Collet - 7.0.18-0.1.RC1Remi Collet - 7.0.17-1Remi Collet - 7.0.17-0.1.RC1Remi Collet - 7.0.16-1Remi Collet - 7.0.16-0.2.RC1Remi Collet 7.0.16-0.1.RC1Remi Collet 7.0.15-1Remi Collet 7.0.15-0.1.RC1Remi Collet 7.0.14-1Remi Collet 7.0.13-2Remi Collet 7.0.14-0.1.RC1Remi Collet 7.0.13-1Remi Collet 7.0.13-0.1.RC1Remi Collet 7.0.12-2Remi Collet 7.0.12-1Remi Collet 7.0.12-0.1.RC1Remi Collet 7.0.11-1Remi Collet 7.0.11-0.1.RC1Remi Collet 7.0.10-1Remi Collet 7.0.10-0.2.RC1Remi Collet 7.0.10-0.1.RC1Remi Collet 7.0.9-1Remi Collet 7.0.9-0.1.RC1Remi Collet 7.0.8-1.1Remi Collet 7.0.8-1Remi Collet 7.0.8-0.1.RC1Remi Collet - 2:1.5.10-2Tom Lane 2:1.5.10-1Tom Lane 2:1.5.9-1Tom Lane 2:1.5.8-2Tom Lane 2:1.5.8-1Fedora Release Engineering - 2:1.5.7-2Tom Lane 2:1.5.7-1Tom Lane 2:1.5.6-2Tom Lane 2:1.5.6-1Tom Lane 2:1.2.46-1Fedora Release Engineering - 2:1.2.44-3Ville Skyttä - 2:1.2.44-2Tom Lane 2:1.2.44-1Tom Lane 2:1.2.43-1Tom Lane 2:1.2.42-1Tom Lane 2:1.2.39-1Fedora Release Engineering - 2:1.2.37-2Tom Lane 2:1.2.37-1Tom Lane 2:1.2.35-1Fedora Release Engineering - 2:1.2.34-2Tom Lane 2:1.2.34-1Caolán McNamara 2:1.2.33-2Tom Lane 2:1.2.33-1Tom Lane 2:1.2.31-2Tom Lane 2:1.2.31-1Tom Lane 2:1.2.29-1Tom Lane 2:1.2.24-1Tom Lane 2:1.2.22-1Tom Lane 2:1.2.16-3Tom Lane 2:1.2.16-2Tom Lane 2:1.2.16-1Jesse Keating - 2:1.2.10-7Matthias Clasen - 2:1.2.10-6Jesse Keating - 2:1.2.10-5.1Matthias Clasen - 2:1.2.10-5Matthias Clasen - 2:1.2.10-4Matthias Clasen - 2:1.2.10-3Matthias Clasen - 2:1.2.10-2Matthias Clasen - 2:1.2.10-1Jesse Keating - 2:1.2.8-2.2.1Jesse Keating - 2:1.2.8-2.2Jesse Keating Matthias Clasen - 2:1.2.8-2Matthias Clasen - 2:1.2.8-1Matthias Clasen - 2:1.2.7-1Matthias Clasen - 2:1.2.6-1Matthias Clasen 2:1.2.5-9Matthias Clasen Matthias Clasen 2:1.2.5-8Matthias Clasen 2:1.2.5-7Elliot Lee Matthias Clasen - 2:1.2.5-5Matthias Clasen - 2:1.2.5-4Matthias Clasen - 2:1.2.5-3Than Ngo 2:1.2.5-2Matthias Clasen 2:1.2.5-1Matthias Clasen 2:1.2.2-22Matthias Clasen Matthias Clasen Elliot Lee Mark McLoughlin 2:1.2.2-19Elliot Lee Elliot Lee Jeff Johnson Jonathan Blandford 2:1.2.2-15Elliot Lee Jonathan Blandford 2:1.2.2-12Jonathan Blandford Karsten Hopp 2:1.2.2-11Tim Powers Elliot Lee 2:1.2.2-9Tim Powers 2:1.2.2-7Tim Powers Tim Powers Bernhard Rosenkraenzer 1.2.2-4Bernhard Rosenkraenzer 1.2.2-3Bernhard Rosenkraenzer 1.2.2-2Havoc Pennington Tim Powers Bernhard Rosenkraenzer 1.2.1-1Bernhard Rosenkraenzer 1.2.0-1Trond Eivind Glomsrd Than Ngo 1.0.12-1Bernhard Rosenkraenzer 1.0.11-2Bernhard Rosenkraenzer 1.0.11-1Bernhard Rosenkraenzer Bernhard Rosenkraenzer Bernhard Rosenkraenzer Bernhard Rosenkraenzer Bernhard Rosenkraenzer Florian La Roche Preston Brown Prospector Bernhard Rosenkraenzer Nalin Dahyabhai Nalin Dahyabhai Nalin DahyxX0Xh $X $rMR7t$sWf Yf6ʕ9L;& k PRO*ĉE=uT?\nK+y]`JĥkSjrKbE>F0:F+c{+@t(!9]r}t~6^輵Z[O&%,jaloLU.Qj"(o 5BZh#dJ mzc-WdpuaR#Eb~lHID {LۜbY:cgݬOr"vq3Xi@ Cr+oHОN}\t3 Bpv7t8f|+FXfr|!kCf*T'q4{&_-mȲ34oPCZ;H=ȺX1zzWS*K$ƨ9ruU@0[> xyL/Ggo fvXN>Z[W# s:[:٫ G&T BX'W(;^9}:[;i#@=$9J8 bGa)Q_@zrIOqvA=9 RR/p/gwN bWF8Biw(sCN!YV)  ̙O!*bt}5ߗHTK1)ڡ'R&nqءOi uM hgVwҏ(9a7829338bbb7df9067579dc6845f17aeb55585ebM@bLall race window when adding new layout to global list (Steve Dickson) [1217590] - [fs] nfs/flexclient: export pnfs_layoutcommit_inode (Steve Dickson) [1217590] - [fs] nfs: set hostname when creating nfsv3 ds connection (Steve Dickson) [1217590] - [fs] sunrpc: add rpc_count_iostats_idx (Steve Dickson) [1217590] - [fs] sunrpc: serialize iostats updates (Steve Dickson) [1217590] - [fs] nfsv4.1/nfsv3: Add pNFS callbacks for nfs3_(read|write|commit)_done() (Steve Dickson) [1217590] - [fs] nfs: allow to specify cred in nfs_initiate_pgio (Steve Dickson) [1217590] - [fs] nfs4: export nfs4_sequence_done (Steve Dickson) [1217590] - [fs] nfs4: pass slot table to nfs40_setup_sequence (Steve Dickson) [1217590] - [fs] nfs: allow different protocol in nfs_initiate_commit (Steve Dickson) [1217590] - [fs] pnfs: Add nfs_rpc_ops in calls to nfs_initiate_pgio (Steve Dickson) [1217590] - [fs] nfs41: create NFSv3 DS connection if specified (Steve Dickson) [1217590] - [fs] nfs41: allow LD to choose DS connection version/minor_version (Steve Dickson) [1217590] - [fs] nfsv3: introduce nfs3_set_ds_client (Steve Dickson) [1217590] - [fs] nfs41: move file layout macros to generic pnfs (Steve Dickson) [1217590] - [fs] nfs41: allow LD to choose DS connection auth flavor (Steve Dickson) [1217590] - [fs] nfs41: pull nfs4_ds_connect from file layout to generic pnfs (Steve Dickson) [1217590] - [fs] nfs41: pull decode_ds_addr from file layout to generic pnfs (Steve Dickson) [1217590] - [fs] nfs41: pull data server cache from file layout to generic pnfs (Steve Dickson) [1217590] - [fs] pnfs: Do not grab the commit_info lock twice when rescheduling writes (Steve Dickson) [1217590] - [fs] pnfs: Prepare for flexfiles by pulling out common code (Steve Dickson) [1217590] - [fs] cifs: Fix readpages retrying on reconnects (Sachin Prabhu) [1197696] - [fs] Update cifs version (Sachin Prabhu) [1197696] - [fs] cifs: Fix STATUS_CANNOT_DELETE error mapping for SMB2 (Sachin Prabhu) [1197696] - [fs] cifs: Optimize readpages in a short read case on reconnects (Sachin Prabhu) [1197696] - [fs] cifs: Optimize cifs_user_read() in a short read case on reconnects (Sachin Prabhu) [1197696] - [fs] cifs: Improve indentation in cifs_user_read() (Sachin Prabhu) [1197696] - [fs] cifs: Fix possible buffer corruption in cifs_user_read() (Sachin Prabhu) [1197696] - [fs] cifs: Count got bytes in read_into_pages() (Sachin Prabhu) [1197696] - [fs] cifs: Use separate var for the number of bytes got in async read (Sachin Prabhu) [1197696] - [fs] cifs: Indicate reconnect with ECONNABORTED error code (Sachin Prabhu) [1197696] - [fs] cifs: Use multicredits for SMB 2.1/3 reads (Sachin Prabhu) [1197696] - [fs] cifs: Fix rsize usage for sync read (Sachin Prabhu) [1197696] - [fs] cifs: Fix rsize usage in user read (Sachin Prabhu) [1197696] - [fs] cifs: Separate page reading from user read (Sachin Prabhu) [1197696] - [fs] cifs: Fix rsize usage in readpages (Sachin Prabhu) [1197696] - [fs] cifs: Separate page search from readpages (SacxXdUF$<doraproject.org> - 7.1.3-1Remi Collet - 7.1.3-0.2.RC1Remi Collet - 7.1.3-0.1.RC1Remi Collet - 7.1.2-1Remi Collet - 7.1.2-0.2.RC1Remi Collet 7.1.2-0.1.RC1Remi Collet 7.1.1-3Remi Collet 7.1.1-2Remi Collet 7.1.1-1Remi Collet 7.1.1-0.1.RC1Remi Collet 7.1.0-2Remi Collet 7.1.0-1Remi Collet 7.1.0-0.13.RC6Remi Collet 7.1.0-0.12.RC5Remi Collet 7.1.0-0.11.RC4Remi Collet 7.1.0-0.10.RC3Remi Collet 7.1.0-0.9.RC3Remi Collet 7.1.0-0.8.RC2Remi Collet 7.1.0-0.8.RC1Remi Collet 7.1.0-0.7.beta2Remi Collet 7.1.0-0.6.beta1Remi Collet 7.1.0-0.5.alpha3Remi Collet 7.1.0-0.4.alpha2Remi Collet 7.1.0-0.3.alpha2Remi Collet 7.1.0-0.2.alpha2Remi Collet 7.1.0-0.1.alpha1Remi Collet 7.0.7-1Remi Collet 7.0.7-0.1.RC1Remi Collet 7.0.6-3Remi Collet 7.0.6-2Remi Collet 7.0.6-0.2.RC1Remi Collet 7.0.5-2Remi Collet 7.0.5-1Remi Collet 7.0.5-0.1.RC1Remi Collet 7.0.4-2Remi Collet 7.0.4-1Remi Collet 7.0.4-0.1.RC1Remi Collet 7.0.3-1Remi Collet 7.0.3-0.3.20160129gitdd3d10cRemi Collet 7.0.3-0.2.RC1Remi Collet 7.0.3-0.1.RC1Remi Collet 7.0.2-1Remi Collet 7.0.2-0.1.RC1Remi Collet 7.0.1-1Remi Collet 7.0.1-0.1.RC1Remi Collet 7.0.0-2Remi Collet 7.0.0-1Remi Collet 7.0.0-0.26.RC8Remi Collet 7.0.0-0.25.RC8Remi Collet 7.0.0-0.24.RC7Remi Collet 7.0.0-0.23.RC7Remi Collet 7.0.0-0.22.RC6Remi Collet 7.0.0-0.21.RC5Remi Collet 7.0.0-0.20.RC5Remi Collet 7.0.0-0.19.RC5Remi Collet 7.0.0-0.18.RC4Remi Collet 7.0.0-0.17.RC3Remi Collet 7.0.0-0.16.RC3Remi Collet 7.0.0-0.15.RC2Remi Collet 7.0.0-0.14.RC1Remi Collet 7.0.0-0.13.beta3Remi Collet 7.0.0-0.12.beta2Remi Collet 7.0.0-0.11.beta1Remi Collet 7.0.0-0.10.alpha2Remi Collet 7.0.0-0.9.20150617git3697f02Remi Collet 7.0.0-0.9.20150611git8cfe282Remi Collet 7.0.0-0.8.alpha1Remi Collet 7.0.0-0.7.20150602git8a089e7Remi Collet 7.0.0-0.7.20150525git6f46fa3Remi Collet 7.0.0-0.6.20150525git404360fRemi Collet 7.0.0-0.6.20150518gitcee8857Remi Collet 7.0.0-0.6.20150515gitc9f27eeRemi Collet 7.0.0-0.6.20150507gitdd0b602Remi Collet 7.0.0-0.5.20150428git94f0b94Remi Collet 7.0.0-0.5.20150427git1a4d3e4Remi Collet 7.0.0-0.5.20150418git1f0a624Remi Collet 7.0.0-0.5.20150416gitc77d97fRemi Collet > > ? (?8@9B:`GHI@XY\]^SbdefltuLv&wxy 8LPh x hglhpCfreetype-devel2.814.el7_9.1FreeType development libraries and header filesThe freetype-devel package includes the static libraries and header files for the FreeType font rendering engine. Install freetype-devel if you want to develop programs which will use FreeType._Yx86-02.bsys.centos.org-{aCentOS(FTL or GPLv2+) and BSD and MIT and Public Domain and zlib with acknowledgementCentOS BuildSystem Development/Librarieshttp://www.freetype.orglinuxx86_64Of_)Ms9gj0t%8h,ip4W',1ArBwm5(,8%P@W): <a(/O)  O<W&037oRN#``N&H?"45L(3t =d_.5֕@R#j= !j}7Hm!uO3F,H|;;!g+ #()cV@V#C.MH)&?GV*y+K X=rAAA큤A큤A큤A큤A큤A큤_Y_Y_Y_Y_Y_~_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_Y_YYxY[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y#Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[YXmI YYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYY_YY[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[Y[_Y2f3a9a0ea4ca42c03bef01d50941693b285d3e5de6eacf6b399007b26d3aa27501d7f3476218aa643ab23067ebd6544304066abfa959550d67683793dbb62e53b89f024c962557b3c5d9a95f194860e674f7bb49528accce98e7a5908809c9d51d2c9148c4e867156d4fa80286cb7a9926c4b471608e7d309f52cc2bdfd20e5929fe591865d369426b8d0796724a83b09b2eb946d1241648e6e024a418627eedbb8cc93fe89c1a5d42ebbb1bdb74ba4753b0f18c708bef542640f5fdb8f9804186934b945c1f8bce7f37b36b2b4e50d66ce40096362ec9d90991255da42b05120871ceb538fd73b7e55f344755596d60a72295dc36d0xxXU`x<$ <<<410b11383470c8be0b0c3620202f71b775080eaeff00a6b1cfda9095eaea1fa8c6466ee00d9f5cd236563b27d9d2943968392c9a2a2ee82baa4714dee05679a1737122b1f573e6a7708c425ffcd5fe50822ff9771c9d94c832ff419d51673983886aa8d10489e2c853a991b164ebf603b4b6702df072608cbda4ca80f9a462694399f1bc0e416314d7a8bb2186f4c11f195e552ea3a7d63e392b93905e7a84d5a9ed07bbd9e9908eb77a1413d87d06d3711f7d78b90f22544f038677c0e12b4c3ae71b850adb947ed485a2d8ce194b35bf49dd2c80a314e76f78635f42220ce211613df59f77d6c6f31db7f7506d4c0a1684eeff5d49d5f2c2fec05c93825fa754957c59436d9da997c420f323a3ba2cd8e221df4659d4a29cc234ba06a35650c0343e6edf0ad7a29f7a94774a0cf48541facc0d249fa6b657fb392ff5ffd806c6c037d026faa67c1f6fa88ad2d90c6404728031f96c7eddb9676cfecc8544b1bbe0d7b5e082273ae3426b1f4c1b4465dc140a1b2c4665f4b8a85bb8e8fe349c051ffa955e6fd165a3ddd54b15f2a11389c4435d748972bf9a7549fedfebf662a611b9a130c5e431e7f022122fee3f367d859ecd42fb230cf42c09e5cd8fc883d0e5a29d238284fc76d0833e5acc8c2f469916014f179ec9349d184be8b3a392fb7b31af45898ceaa02e5bf4540cc2a6cbb56baa1f67c73f931211563d1caeb6ea66b6e9d0a5864c8afbbc0a267c434822beae291544a48c3cda9ce03817292fd415dacfa362863d5194729f1f21fbc0ed4dbec6c056b7b598c465d5022904db0335c00bf494354f2892907b899302fa8122124053ee80b6b69c1dadda7fec1c4a23d08befc5e44abd7d47e814ddbc152c9ef0a701be016195b3c4fa970f3727e1dda899f7d44f6a638c5c4850a6873ba302c84d3cd972e2b6e6f32399fbf2ce330b8f7bd2e5132601b966d5964690473e7378baba25a5633f25e904fb8078168f3543074ac978606af1a2d7f2f8c66187636817c602b82996e65546961c79bbf29b125f4e7fa77c7e9ee184cc356c2c1f257beeb2b3055204765acf6b5e412a54cacb8ff83b45dcc74412b36c03cd0053513eddca20cc884e084eff6d6c88ce532c816e0b9413ed419d7c21d883115355f51214a018a84b3baca5fbafadc9b288828d620095b51fb1d4dc49231483efc2dca4d708560ffdf07f4326a23c9c67aca9fd6d10fe64d82366f34e888fae7599d4bebaa1bde43ad511a416692f4db69237d8bd1be1503711dc2ae2c105eaef07083056fd191def6607c374cc1870d7b801f72d92abeda6d9c77458167170faf3c923d8e32a4f26330278bdd1abe501685ef79dfcf7c963582ba62835187295aa6e6774441fc71e6e55b696068c728bb0e791ae50e33e8a70ff76083533eaaa01ef072f77ac9e6eb468220597dd64693daeaf374d8e75d1721003a31fd5933e8a8c723cb8520ce3e98a5c6ebf3ded49ecd083dd2737abb9c93695a6f39bb2f040b0246f473ca1b75bf5ae3411c33eaf3a84cde708873ad06680c97bd217c191c9ccb46ff341cd7bd3d676cb1b2847f22b14f4e7778a2eeecf826b41a0aa976ad0793536e41a8c6c6aca005cf407daf2ec94ec419a19323dae1e7423721c6e410a222ad8afee81331aa580c4f6a2fb7a7867d45be98b21a6b5bc37efcaa16f0f4d38ddaed8713ab35027e370ce4193710a537efde32b447f6865ceff44afb3b505e51c5643c62f6729dd73a563bd23bd1a0ed2aba4265becc820f30bb2d931770797289b928808c3e663326e668106930036290ffc01a83a8f10faf604fd4e9bdf3b9fd2d4b9df17a1e5cf25689827d5478d58a12d970e1515751c80773ed7a4ac991c9898be1fca4243deb5aeb105b065c61c6042c46299854917f67332790277186c0cf0692471abc33fee14f0c2224edb2dae456e384791abc63e3e6d7031a606b00657c55a6c9afb9a793bf7c73992b542e80f569089f1a304adb83c237430482b3edf644ef4c40cb3e6d196268935511c443fd3fc0044c3a5fcfa0f61ae68cdcb1f4949427b47cc191adf67b4e50f65675ad5bc55c2d3845b971dcda63132c0297a4da38603ef8de4a3d64c8ca032749890c04632e1f6a48cf5e952acdca2dbb000b798695daf94c4e2f1b4c8440ac87ce1fb71a8e03809761902b46ee31aa9cc448ba97019caff3ac5a404439963042ca694e3cac264c996994f8febc084edcdf0ba4f23f9b0e0b7b5b08b413620c8a0b416ad594a10f908e6fa564331ca41d672b3fca9a797658fe7669028861ae0d090e258de6534c9b18e09a82524eedbdf9d142c379d994e149847ea66442d7be30ade7126a46d67cd8c241240a415fd652372699483fc52c6863a2ed36616c681d31915b03e060964d883c9ee1754f20e786e100f3e67c19fff63bd17896c9c6e3f7af004c0c79033d71290c05c5a20031f2f5d25bf956fab376c77999eda8f21fd011611f0d241a1964a1daaf7d9088150978ee92f9919bb2e3e3ccb14ceefcc293680888c35716efb5c8e13e0ceeb96451bda2c74e1fff56fe9a3f13f30b21e66746e567f7b097761ca0ff653e54b8c328556c8eacfe6d89d059ab6140369ddec9a30502792779d669cea33f89bbc3f39e136195945a1fc0901c95afc2b2a01911f9268455ba28fe83bdddecfef4b2acbf0f22d8a82a6a76c663178d812eea2cf1ded36b7c372ed39fc7cb6092d4d1ded1645a4b658bbddb56892f41ed490732e76b82c8478858ff1540ca179b090149b829a9cc8d133687035e180b01ab0fe300518c8c8a467bf041fb889620d85959dxXV8k0\mI$}mIlInIams - 1:0.7.0-0.3.svn3020Dan Williams - 1:0.7.0-0.3.svn3016Dan Williams - 1:0.7.0-0.3.svn3014Dan Williams - 1:0.7.0-0.3.svn3008Dan Williams - 1:0.7.0-0.3.svn2995Dan Williams - 1:0.7.0-0.3.svn2994Dan Williams - 1:0.7.0-0.3.svn2983Dan Williams - 1:0.7.0-0.3.svn2970Dan Williams - 1:0.7.0-0.3.svn2962Dan Williams - 1:0.7.0-0.3.svn2961Dan Williams - 1:0.7.0-0.3.svn2914Dan Williams - 1:0.7.0-0.3.svn2907Dan Williams - 1:0.7.0-0.3.svn2886Dan Williams - 1:0.7.0-0.3.svn2880Dan Williams - 1:0.7.0-0.3.svn2852Dan Williams - 1:0.7.0-0.3.svn2849Dan Williams - 1:0.7.0-0.3.svn2844Dan Williams - 1:0.7.0-0.2.svn2833Dan Williams - 1:0.7.0-0.1.svn2736Christopher Aillon 1:0.6.5-9Christopher Aillon 1:0.6.5-8Dan Williams 1:0.6.5-7Dan Williams 1:0.6.5-6Dan Williams 1:0.6.5-5Dan Williams 1:0.6.5-4Dan Williams 1:0.6.5-3Christopher Aillon 1:0.6.5-2Christopher Aillon 1:0.6.5-1Dan Williams - 1:0.6.5-0.7.svn2547Matthew Barnes 1:0.6.5-0.6.svn2474Matthias Clasen 1:0.6.5-0.5.svn2474Dan Williams - 1:0.6.5-0.4.svn2474Christopher Aillon - 1:0.6.5-0.3.cvs20061025Christopher Aillon - 1:0.6.5-0.2.cvs20061025Matthias Clasen Dan Williams - 1:0.6.5-0.cvs20061025Christopher Aillon - 1:0.6.4-6Christopher Aillon - 1:0.6.4-5Bill Nottingham - 1:0.6.4-4Dan Williams - 1:0.6.4-3Dan Williams - 1:0.6.4-2Christopher Aillon - 0.7.0-0.cvs20060529.7Ray Strode - 0.7.0-0.cvs20060529.6Ray Strode - 0.7.0-0.cvs20060529.5Ray Strode - 0.7.0-0.cvs20060529.4John (J5) Palmieri - 0.7.0-0.cvs20060529.3John (J5) Palmieri - 0.7.0-0.cvs20060529.2Jesse Keating - 0.7.0-0.cvs20060529.1.1Dan Williams - 0.7.0-0.cvs20060529Dan Williams - 0.7.0-0.cvs20060521Bill Nottingham - 0.6.2-3.fc6Jeremy Katz - 0.6.2-2.fc6Dan Williams - 0.6.2-1Peter Jones - 0.6.0-3Dan Williams 0.6.0-2Dan Williams 0.6.0-1Jeremy Katz - 0.5.1-18.cvs20060302Christopher Aillon Dan Williams 0.5.1-18.cvs20060301Christopher Aillon 0.5.1-17.cvs20060228Christopher Aillon 0.5.1-16.cvs20060227Christopher Aillon 0.5.1-15.cvs20060227Dan Williams 0.5.1-14.cvs20060221Dan Williams 0.5.1-13.cvs20060221Dan Williams 0.5.1-12.cvs20060213Christopher Aillon 0.5.1-11.cvs20060205Jesse Keating 0.5.1-10.cvs20060205.1Dan Williams 0.5.1-10.cvs20060205Dan Williams 0.5.1-9.cvs20060202Dan Williams 0.5.1-8.cvs20060131Dan Williams 0.5.1-7.cvs20060131Dan Williams 0.5.1-6.cvs20060127Jesse Keating John (J5) Palmieri - 0.5.1-5Peter Jones - 0.5.1-4Christopher Aillon - 0.5.1-3Christopher Aillon - 0.5.1-2Christopher Aillon - 0.5.0-2Dan Williams - 0.4.1-5.cvs20051010Dan WilliamsxhXWxÃ$SÃăƒjson is now build statically- new snapshot - build phpdbg only once- new snapshot- use php-config from embed SAPI to reduce used libs- new snapshot- new snapshot- new snapshot- new snapshot - enchant: use libenchant-2 instead of libenchant- new snapshot - test build for https://github.com/php/php-src/pull/5480- new snapshot - fix tag=disable-static- new snapshot - revert changes to use non PIC object files- new snapshot- new snapshot- new snapshot - refresh php.ini from upstream - rename 15-php80-php.conf to 20-php70-php.conf to ensure load order- update to 8.0.0-dev- update to 7.4.5RC1- Update to 7.4.4 - http://www.php.net/releases/7_4_4.php - use oracle client library version 19.6 (18.5 on EL-6)- update to 7.4.4RC1- Update to 7.4.3 - http://www.php.net/releases/7_4_3.php- update to 7.4.3RC1- make sodium mandatory on EL-7, to avoid user confusion https://github.com/remicollet/remirepo/issues/137- Update to 7.4.2 - http://www.php.net/releases/7_4_2.php- update to 7.4.2RC1- Update to 7.4.1 - http://www.php.net/releases/7_4_1.php- update to 7.4.1RC1 - use oracle client library version 19.5- update to 7.4.0 GA- update to 7.4.0RC6- update to 7.4.0RC5 - set opcache.enable_cli in provided default configuration- add /usr/share/php/preload as default ffi.preload configuration- allow wildcards in ffi.preload- fix preload, add more upstream patches for #78713 #78716- fix preload, add upstream patch for #78512- update to 7.4.0RC4- test build with more upstream patches- fix librt issue on F31 using upstream patch- ensure all shared extensions can be loaded- fix broken intl extension on EL-7- update to 7.4.0RC3- fix broken gmp extension https://bugs.php.net/78574- update to 7.4.0RC2 (new tag)- update to 7.4.0RC2 - add tarball signature check - reduce to 4 concurrent test workers- update to 7.4.0RC1 - bump API number to 20190902- update to 7.4.0beta4- update to 7.4.0beta2- update to 7.4.0beta1 (new tag)- update to 7.4.0beta1 - main package now recommends commonly used extensions and SAPI (json, mbstring, opcache, pdo, xml) - fix gd build options and dependencies - refresh provided configuration from upstream production values- drop recode extension, moved to php-pecl-recode - add upstream patch for argon2 password- update to 7.4.0alpha3 - drop argon2 dependency using libsodium implementation- update to 7.4.0alpha2- use oracle client library version 19.3- add 3 upstream patches- update to 7.4.0alpha1- new snapshot - use pkgconfig dependencies for libxslt, libexslt, libsasl2, libargon2- new snapshot- new snapshot - bump ABI version - add patch for old unixODBC from https://github.com/php/php-src/pull/4203- new snapshot- new snapshot with configuration updated from upstream- new snapshot for enchant and sodium fix- new snapshot for sqlite3 fix- update to 7.4.0-dev - drop interbase extension and sub-package - move pdo_firebird extension in pdo-firebird sub-package - drop wddx extension - add ffi extension in new ffi sub-package - use pkgconfig dependencies for ext using PHP_CHECK_MODULE- update to 7.3.6RC1 (new tag)- update to 7.3.6RC1- test build for https://bugs.php.net/77653 patch from https://github.com/php/php-src/pull/4007- Update to 7.3.5 - http://www.php.net/releases/7_3_5.php- update to 7.3.5RC1- build with system oniguruma5- test build for https://bugs.php.net/77653 patch from https://github.com/php/php-src/pull/4007- Update to 7.3.4 - http://www.php.net/releases/7_3_4.php- update to 7.3.4RC1 new tag - add upstream patches for failed tests- update to 7.3.4RC1- Update to 7.3.3 - http://www.php.net/releases/7_3_3.php - add upstream patch for OpenSSL 1.1.1b- php-devel: drop dependency on libicu-devel- update to 7.3.3RC1 - adapt systzdata patch (v18)- pdo_oci: backport PDOStatement::getColumnMeta from 7.4- rebuild using libicu62- Update to 7.3.2 - http://www.php.net/releases/7_3_2.php- update to 7.3.2RC1 - update system tzdata patch for timelib 2018.01- cleanup for EL-8- test build for https://bugs.php.net/77430- UpdatexXV8hjI$zjIiIkIn Williams - 0.9.8.1-2.git20130507Dan Williams - 0.9.8.1-1.git20130327Jiří Klimeš - 0.9.8.0-1Dan Williams - 0.9.7.997-2Dan Williams - 0.9.7.997-1Dan Winship - 0.9.7.0-12.git20121004Jiří Klimeš - 0.9.7.0-11.git20121004Dan Winship - 0.9.7.0-10.git20121004Dan Winship - 0.9.7.0-9.git20121004Jiří Klimeš - 0.9.7.0-8.git20121004Daniel Drake - 0.9.7.0-7.git20121004Dan Winship - 0.9.7.0-6.git20121004Dan Winship - 0.9.7.0-5.git20121004Dan Winship - 0.9.7.0-4.git20121004Dan Williams - 0.9.7.0-3.git20121004Dan Winship - 0.9.7.0-2.git20121004Dan Winship - 0.9.7.0-1.git20120820Fedora Release Engineering - 1:0.9.5.96-2Dan Williams - 0.9.5.96-1Jiří Klimeš - 0.9.5.95-1.git20120713Jiří Klimeš - 0.9.4-5.git20120521Dan Winship - 0.9.4-4.git20120502Jiří Klimeš - 0.9.4-3.git20120502Colin Walters - 1:0.9.4-2.git20120328_2Jiří Klimeš - 0.9.4-1.git20120328_2Dan Williams - 0.9.3.997-2Dan Williams - 0.9.3.997-1Dan Williams - 0.9.3.997-0.7Dan Williams - 0.9.3.995-0.6Dan Williams - 0.9.3.995-0.5Dan Williams - 0.9.3.995-0.4Dan Horák - 0.9.3-0.3Dan Williams - 0.9.3-0.2Dan Williams - 0.9.3-0.1Matthias Clasen - 0.9.2-4Fedora Release Engineering - 1:0.9.2-3Daniel Drake - 0.9.2-2Dan Williams - 0.9.2-1Adam Williamson - 1:0.9.1.90-5.git20110927Dan Williams - 0.9.1.90-3.git20110927Jiří Klimeš - 0.9.1.90-2.git20110927Dan Williams - 0.9.1.90-1Tom Callaway - 0.9.0-2Dan Williams - 0.9.0-1Ray Strode 0.8.9997-7.git20110721Dan Williams - 0.8.9997-6.git20110721Dan Williams - 0.8.9997-5.git20110702Dan Williams - 0.8.9997-4.git20110620Dan Williams - 0.8.9997-3.git20110613Dan Williams - 0.8.9997-2.git20110531Dan Williams - 0.8.9997-1.git20110531Dan Williams - 0.8.999-3.git20110526Dan Williams - 0.8.999-2.git20110509Dan Williams - 0.8.999-1Dan Williams - 0.8.998-4.git20110427Dan Williams - 0.8.998-3.git20110419Dan Williams - 0.8.998-2.git20110406Dan Williams - 0.8.998-1Dan Williams - 0.8.997-8.git20110331Dan Williams - 0.8.997-7.git20110330Christopher Aillon - 0.8.997-6.git20110328Dan Williams - 0.8.997-5.git20110328Dan Williams - 0.8.997-4.git20110325Dan Williams - 0.8.997-3.git20110324Dan Williams - 0.8.997-2.git20110324Dan Williams - 0.8.997-1Dan Williams - 0.8.996-1Dan Williams - 0.8.995-4.git20110308Dan Williams - 0.8.995-3.git20110308Matthias Clasen - 0.8.995-2.git20110308Dan Williams - 0.8.995-1.git20110308Matthias Clasen - 0.8.2-8.git20101117Fedora Release Engineering - 1:0.8.2-7.git20101117Matthias Clasen - 0.8.2-6.git20101117Dan Williams - 0.8.2-5.git20101117Matthias Clasen - 0.8.2-4.git20101xX}X*X$!emi@remirepo.net> - 1.1.2-2Remi Collet - 1.1.2-1Remi Collet - 1.1.1-2Remi Collet - 1.1.1-1Remi Collet - 1.1-6Remi Collet - 1.1-5Remi Collet - 1.0-5Remi Collet - 1.0-4Remi Collet - 1.0-2Remi Collet - 1.0-1Remi Collet - 0.13-0.1.20160113git50d97a5Remi Collet - 0.12-6Remi Collet - 0.12-5.1Remi Collet - 0.12-5Remi Collet - 0.12-4Remi Collet - 0.12-3Remi Collet - 0.12-2Remi Collet - 0.12-1.1Remi Collet - 0.12-1Remi Collet - 0.11.3-2Remi Collet - 0.11.3-1Remi Collet - 0.11.2-1.1Remi Collet - 0.11.2-1Fedora Release Engineering - 0.11.0-7Chris Weyl 0.11.0-6Chris Weyl - 0.11.0-5Fedora Release Engineering - 0.11.0-4Remi Collet - 0.11.0-3Fedora Release Engineering - 0.11.0-2Itamar Reis Peixoto 0.11.0-1Itamar Reis Peixoto 0.10-2Itamar Reis Peixoto 0.10-1- update to 1.4.1 - use libssh2 1.11- rebuild for PHP 8.3.0RC1- build out of sources tree- EL-7 and EL-8: rename 40-ssh2.ini to 19-ssh2.ini to ensure ssh2 extension is loaded before curl extension- update to 1.4- rebuild againt remi-libssh2 on EL-7 and EL-8- rebuild for 8.1.0RC1- update to 1.3.1 (no change)- update to 1.3 - drop patch merged upstream- rebuild for PHP 8.0.0RC1- add fix for PHP 8 from https://github.com/php/pecl-networking-ssh2/pull/42- rebuild- update to 1.2- rebuild for 7.4.0RC1- rebuild for 7.4.0beta1- rebuild for 7.3.0beta2 new ABI- rebuild for 7.3.0alpha4 new ABI- add upstream patches for 7.3- Update to 1.1.2 (alpha, no change)- rebuild for PHP 7.2.0beta1 new API- Update to 1.1.1 (alpha, no change)- rebuild for 7.2.0alpha2- Update to 1.1 (alpha)- rebuild with PHP 7.1.0 GA- add patch for parse_url change in PHP 7.0.13- rebuild for PHP 7.1 new API version- update to 1.0- update to 0.13-dev, git snapshot, for PHP 7- allow build against rh-php56 (as more-php56) - drop runtime dependency on pear, new scriptlets- Fedora 21 SCL mass rebuild- rebuild for new libssh2 in EL-5 - ensure dependency on libssh2 used at buildtime- improve SCL build- add numerical prefix to extension configuration file (php 5.6)- cleanups for Copr - adap for SCL - install doc in pecl doc_dir- also provides php-ssh2- update to 0.12 - raise dependency on libssh2 >= 1.2- build against php 5.4- update to 0.11.3 - zts extension- EL-5 rebuild for libssh2 - add filter- update to 0.11.2 - add minimal %check- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- bump for libssh2 rebuild- rebuild for libssh2 1.2- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- add ssh2-php53.patch - rebuild for new PHP 5.3.0 ABI (20090626)- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- convert package.xml to V2 format, update to 0.11.0 #BZ 476405- Install pecl xml, license and readme files- Initial release/bin/sh/bin/sh1.4.11.4.11.4.11.4.11.4.1-1.el7.remi1.4.1-1.el7.remi19-ssh2.inissh2.sossh2README.mdphp72-php-pecl-ssh2-1.4.1LICENSEphp72-php-pecl-ssh2.xml/etc/opt/remi/php72/php.d//opt/remi/php72/root/usr/lib64/php/modules//opt/remi/php72/root/usr/share/doc/pecl//opt/remi/php72/root/usr/share/doc/pecl/ssh2//opt/remi/php72/root/usr/share/licenses//opt/remi/php72/rootxlXVFj$Ijjje change- fix pr63567-2.c and pr63567-4.c- fix mode mismatch in prepare_cmp_insn (#1641329, PR target/63442) - allow libitm to use HTM (#1659698) - fix up memset handling in DSE (#1640805, PR rtl-optimization/69891) - fix bits/bytes confusion in set_noop_p (#1594975, PR rtl-optimization/68814) - enable initializing statics with COMPOUND_LITERAL_EXPR in C99 (#1672652, PR c/63567) - fix PIC_OFFSET_TABLE_REGNUM (#1614326) - quash spurious -Wmissing-field-initializers warnings (#1633716, PR c/60784) - fix ICE with alias template (#1648161, PR c++/53658)- Avoid code generation bug due to incorrect CFG in the presence of setjmp/longjmp (#1655148).- back out the last change- adjust C++11 signatures to take a const_iterator (#1575888)- fix infinite looping in -fipa-cp-clone (#1546372) - don't look for vsld gcc.target/powerpc/pr72717.c- Fix two minor problems with the backported spectre updates from upstream. (#1537828)- Backport various stack-clash and spectre fixes from upstream (#1537828)- backport s390 -mpic-data-is-text-relative feature (#1555397) - fix crash when write follows large read (#1463706) - fix emit_move_insn ICE (#1565536) - add missing rs6000-cpus.def (#1512202)- fix ICE when generating a vector shift by scalar (#1546728)- s390 retpoline support for spectre mitigation (#1552021)- Minor testsuite fixes to clean up test results (#1469697) - retpoline support for spectre mitigation (#1535655)- bump for rebuild with RELRO enabled even for ppc64/ppc64le- Avoid red zone probing for zero residual dynamic allocation (#1469697) - Avoid bogus CFIs for probes in noreturn fucntions on x86/x86_64 (#1469697)- Avoid red zone probe on aarch64 (#1469697)- Sync gcc48-rh1469697-13 patch to upstream (#1469697) - Avoid probing in the red zone for noreturn functions (#1507980, #1469697) - Avoid infinite loop if probing interval is less than guard size (#1469697) - Fix debug information for large probing interval on aarch64 (#1469697) - Fix ICE on ppc port with large probing interval (#1469697) - rebuild to remove static relocations not known to older linkers (#1508968)- rebuild to remove static relocations not known to older linkers (#1508968)- fix gcc.c-torture/execute/pr80692.x - fix divmod expansion (PR middle-end/78416)- fix 27_io/basic_fstream/53984.cc - fix for classes with bases with mutable members (PR c++/77375) - fix handling side-effects of parameters (PR c/77767) - fix combine's make_extraction (PR rtl-optimization/78378) - fix gimplification of const var initialization from COND_EXPR (PR c++/80129) - fix -A / -B to A / B folding (PR middle-end/80362) - fix comparison of decimal float zeroes (PR middle-end/80692) - fix __mulv[dt]i3 and expand_mul_overflow (PR target/82274)- handle exceptions in basic_istream::sentry (#1469384) - don't run pr63354.c on ppc (#1468546) - ensure proxy privatization safety (#1491395) - fix incorrect codegen from rdseed intrinsic use (#1482762, CVE-2017-11671) - on aarch64, remove libatomic.so (#1465510)- Backport stack clash protection from upstream (#1469697)- backport several -mprofile-kernel fixes (#1468546)- fix -mcpu=power8 atomic expansion (#1437220, PR target/69644) - fix .toc alignment (#1487434)- disable emitting profiling in functions marked with a special attribute (#1457969)- properly apply the PR70549 patch (#1349067)- promote reloads of a PLUS to RELOAD_OTHER (#1402585)- add -mstack-protector-guard={tls,global}, -mstack-protector-guard-reg= and -mstack-protector-guard-offset= options on ppc* (#1415952, PR target/78875)- fix up std::rethrow_exception (#1375711, PR libstdc++/62258) - use _Unwind_GetIPInfo in __gcc_personality_v0 (#1387402, PR libgcc/78064) - fix vec_vsx_ld/st on ppc64le (#1389801, PR target/72863, PR target/78084) - fix ICE in gfc_compare_derived_types (#1369183) - fix EH from C++ thunks (#1427412, PR ipa/68184) - on ppc64{,le} emit nop after recursive call if the current function is replaceable (#1420723, PR target/79439) - on aarch64 with -frounding-math use fnmul only with -(a*b) and not witxH\XV8$vis_a() to php <= 5.3.6 behavior (from upstream) with new option (allow_string) for new behavior- add mysqlnd sub-package - drop patch4, use --libdir to use /usr/lib*/php/build - add patch to redirect mysql.sock (in mysqlnd)- update to 5.3.8 http://www.php.net/ChangeLog-5.php#5.3.8- update to 5.3.7 http://www.php.net/ChangeLog-5.php#5.3.7 - merge php-zts into php (#698084)- rebuild for net-snmp SONAME bump- enable mhash extension (emulated by hash extension)- rebuild for new MySQL client library- update to 5.3.6 http://www.php.net/ChangeLog-5.php#5.3.6 - fix php-pdo arch specific requires- disable zip extension per "No Bundled Libraries" policy (#551513)- rebuild for icu 4.6- fix systemd-units requires- add tmpfiles.d configuration for php-fpm - add Arch specific requires/provides- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 5.3.5 http://www.php.net/ChangeLog-5.php#5.3.5 - clean duplicate configure options- rebuild against MySQL 5.5.8 - remove all RPM_SOURCE_DIR- security patch from upstream for #660517- update to 5.3.4 http://www.php.net/ChangeLog-5.php#5.3.4 - move phpize to php-cli (see #657812)- ghost /var/run/php-fpm (see #656660) - add filter_setup to not provides extensions as .so- use mysql_config in libdir directly to avoid biarch build failures- rebuild for new net-snmp- add php-fpm sub-package- PHP 5.3.3 released- garbage collector upstream patches (#580236)- rebuild for icu 4.4- PHP 5.3.2 Released! - remove mime_magic option (now provided by fileinfo, by emu) - add patch for http://bugs.php.net/50578 - remove patch for libedit (upstream) - add runselftest option to allow build without test suite- update to v7 of systzdata patch- fix build with autoconf 2.6x- update to 5.3.1 - remove openssl patch (merged upstream) - add provides for php-pecl-json - add prod/devel php.ini in doc- use libedit instead of readline to resolve licensing issues- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rediff systzdata patch- update to v6 of systzdata patch; various fixes- update to v5 of systzdata patch; parses zone.tab and extracts timezone->{country-code,long/lat,comment} mapping table- update to 5.3.0 - remove ncurses, dbase, mhash extensions - add enchant, sqlite3, intl, phar, fileinfo extensions - raise sqlite version to 3.6.0 (for sqlite3, build with --enable-load-extension) - sync with upstream "production" php.ini- update to 5.2.10 - add interbase sub-package- update to 5.2.9- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add recode support, -recode subpackage (#106755) - add -zts subpackage with ZTS-enabled build of httpd SAPI - adjust php.conf to use -zts SAPI build for worker MPM- fix patch fuzz, renumber patches- drop obsolete configure args - drop -odbc patch (#483690)- split out sysvshm, sysvsem, sysvmsg, posix into php-process- move wddx to php-xml, build curl shared in -common - remove BR for expat-devel, bogus configure option- rebuild for new MySQL- libtool 2 workaround for phpize (#476004) - add missing php_embed.h (#457777)- update to 5.2.8- libtool 2 workaround- update to 5.2.7 - enable pdo_dblib driver in php-mssql- tweak Summary, thanks to Richard Hughes- move gd_README to php-gd - update to r4 of systzdata patch; introduces a default timezone name of "System/Localtime", which uses /etc/localtime (#469532)- enable XPM support in php-gd - Fix BR for php-gd- enable T1lib support in php-gd- update to 5.2.6 - sync default php.ini with upstream - drop extension_dir from default php.ini, rely on hard-coded default, to make php-common multilib-safe (#455091) - update to r3 of systzdata patch- split pspell extension out into php-spell (#443857)- Autorebuild for GCC 4.3- ext/date: use system timezone database- rebuild for libc-client bump- Rebuild for openssl bump- update to 5.2.5- correct pcre BR version (#333021) - restore metaphone fix (#205714) - add READMEs to php-cli- update to 5.2.4- rebuild for fixed APxKXRWX$Vrt (#206981) - libebl: sparc backend support for return value location - libebl, libdwfl: backend register name support extended with more info - libelf, libdw: bug fixes for unaligned accesses on machines that care - readelf, elflint: trivial bugs fixed- Update to 0.123 - libebl: Backend build fixes, thanks to Stepan Kasal. - libebl: ia64 backend support for register names, return value location - libdwfl: Handle truncated linux kernel module section names. - libdwfl: Look for linux kernel vmlinux files with .debug suffix. - elflint: Fix checks to permit --hash-style=gnu format.- Fix warnings in elflint compilation.- Update to 0.122 - Fix libdwfl sorting of modules with 64-bit addresses (#198225). - libebl: add function to test for relative relocation - elflint: fix and extend DT_RELCOUNT/DT_RELACOUNT checks - elflint, readelf: add support for DT_GNU_HASH - libelf: add elf_gnu_hash - elflint, readelf: add support for 64-bit SysV-style hash tables - libdwfl: new functions dwfl_module_getsymtab, dwfl_module_getsym.- Update to 0.121 - libelf: bug fixes for rewriting existing files when using mmap (#187618). - make all installed headers usable in C++ code (#193153). - eu-readelf: better output format. - eu-elflint: fix tests of dynamic section content. - libdw, libdwfl: handle files without aranges info.- rebuild to pick up -devel deps- Update to 0.120 - License changed to GPL, with some exceptions for using the libelf, libebl, libdw, and libdwfl library interfaces. Red Hat elfutils is an included package of the Open Invention Network. - dwarf.h updated for DWARF 3.0 final specification. - libelf: Fix corruption in ELF_C_RDWR uses (#187618). - libdwfl: New function dwfl_version; fixes for offline.- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- update to 0.119- rebuilt- update to 0.118 - elflint: more tests. - libdwfl: New function dwfl_module_register_names. - libebl: New backend hook for register names. - Make sure -fexceptions is always in CFLAGS.- update to 0.117 - libdwfl: New function dwfl_module_return_value_location (#166118) - libebl: Backend improvements for several CPUs- update to 0.116 - libdw fixes, API changes and additions - libdwfl fixes (#169672) - eu-strip/libelf fix to preserve setuid/setgid permission bits (#167745)- Update requires/conflicts for better biarch update behavior.- update to 0.115 - New program eu-strings. - libdw: New function dwarf_getscopes_die. - libelf: speed-ups of non-mmap reading. - Implement --enable-gcov option for configure.- update to 0.114 - new program eu-ranlib - libdw: new calls for inlines - libdwfl: new calls for offline modules- update to 0.113 - elflint: relax a bit. Allow version definitions for defined symbols against DSO versions also for symbols in nobits sections. Allow .rodata section to have STRINGS and MERGE flag set. - strip: add some more compatibility with binutils. - libdwfl: bug fixes. - Separate libdw et al into elfutils-libs subpackage.- update to 0.112 - elfcmp: some more relaxation. - elflint: many more tests, especially regarding to symbol versioning. - libelf: Add elfXX_offscn and gelf_offscn. - libasm: asm_begin interface changes. - libebl: Add three new interfaces to directly access machine, class, and data encoding information.- update portability patch- update to 0.111 - libdwfl library now merged into libdw- update to 0.110- update to 0.109 - verify that libebl modules are from the same build - new eu-elflint checks on copy relocations - new program eu-elfcmp - new experimental libdwfl library- robustification of eu-strip and eu-readelf- more robustification- robustification- update to 0.108 - merge strip fixes - sort records in dwarf_getsrclines, fix dwarf_getsrc_die searching - update elf.h from glibc- fix strip -f byte-swapping bug- update to 0.107 - readelf: improve DWARF output format - elflint: -d option to sx8;XU`<$<<<<x move on non SELinux kernels- Fixed useless acl dependencies (bug #106141).- Fix id -Z- Turn on SELinux - Fix chcon error handling- Turn off SELinux- Turn on SELinux- Turn off SELinux- Turn on SELinux- allow compiling without pam support- Make split(1) handle large files (bug #106700).- Turn off SELinux- Cleanup SELinux patch- Restrict ACL support to only those programs needing it (bug #106141). - Fix default PATH for LSB (bug #102567).- Turn off SELinux- Turn on SELinux- Turn off SELinux- Only call getfilecon if the user requested it. - build with selinux- Documentation fix (bug #102697).- Made su use pam again (oops). - Fixed another i18n bug causing sort --month-sort to fail. - Don't run dubious stty test, since it fails when backgrounded (bug #102033). - Re-enable make check.- Don't run 'make check' for this build (build environment problem). - Another uninitialized variable in i18n (from bug #98683).- Internationalize runcon - Update latest chcon from NSA- Re-enable make check.- Don't run 'make check' for this build (build environment problem).- Actually use the ACL patch (bug #100519).- Convert to SELinux- Removed samefile patch. Now the test suite passes.- rebuilt- Both kon and kterm support colours (bug #83701). - Fix 'ls -l' alignment in zh_CN locale (bug #88346).- Prevent file descriptor leakage in du (bug #90563). - Build requires recent texinfo (bug #90439).- Allow obsolete options unless POSIXLY_CORRECT is set.- Fold bug was introduced by i18n patch; fixed there instead.- fix segfault in fold (#88683)- 5.0.- Use _smp_mflags.- Remove overwrite patch. - No longer seem to need nolibrt, errno patches.- No longer seem to need danglinglink, prompt, lug, touch_errno patches.- 4.5.11. - Use packaged readlink.- 4.5.10. - Update lug, touch_errno, acl, utmp, printf-ll, i18n, test-bugs patches. - Drop fr_fix, LC_TIME, preserve, regex patches.- Fixed another i18n patch bug (bug #82032).- Fix sort(1) efficiency in multibyte encoding (bug #82032).- Ship readlink(1) (bug #84200).- Deal with glibc < 2.2 in %pre scriplet (bug #84090).- Require glibc >= 2.2 (bug #84090).- fix group (#84095)- rebuilt- Fix rm(1) man page.- Fix re_compile_pattern check. - Fix su hang (bug #81653).- Fix memory size calculation.- Fix mv error message (bug #79809).- added PreReq on grep- Fix cp --preserve with multiple arguments.- Turn on colorls for screen (bug #78816).- Fix mv (bug #79283). - Add patch27 (nogetline).- use the su.pamd from sh-utils since it works properly with multilib systems- Fix test suite quoting problems.- Fix scriplets. - Fix i18n patch so it doesn't break uniq. - Fix several other patches to either make the test suite pass or not run the relevant tests. - Run 'make check'. - Fix file list.- Adapted for Red Hat Linux. - Self-host for help2man. - Don't ship readlink just yet (maybe later). - Merge patches from fileutils and sh-utils (textutils ones are already merged it seems). - Keep the binaries where the used to be (in particular, id and stat).- LI18NUX/LSB compliance (patch800) - Installed (but unpackaged) file(s) - /usr/share/info/dir- new release - rediff patch 180 - merge patch 150 into 180- move su back to /bin- patch 0 : lg locale is illegal and must be renamed lug (pablo)- fix conflict with procps- patch 105 : fix install -s- fix build - don't chmode two times su - build with large file support - fix description - various spec cleanups - fix chroot installation - fix missing /bin/env - add old fileutils, sh-utils & textutils ChangeLogs- initial release (merge fileutils, sh-utils & textutils) - obsoletes/provides: sh-utils/fileutils/textutils - fileutils stuff go in 1xx range - sh-utils stuff go in 7xx range - textutils stuff go in 5xx range - drop obsoletes patches 1, 2, 10 (somes files're gone but we didn't ship most of them) - rediff patches 103, 105, 111, 113, 180, 706 - temporary disable patch 3 & 4 - fix fileutils url/bin/sh/bin/sh/bin/shmktempfileutilssh-utilsstattextutilscoreutils-libsx*XeWЪ`v$fvwu - add missing defattr's (thanks to Matthias Saou)- move Obsoletes for php-openssl to -common (#194501) - Provide: php-cgi from -cli subpackage- split out php-cli, php-common subpackages (#177821) - add php-pdo-abi version export (#193202)- rebuilt for new libnetsnmp- provide mod_php (#187891) - provide php-cli (#192196) - use correct LDAP fix (#181518) - define _GNU_SOURCE in php_config.h and leave it defined - drop (circular) dependency on php-pear- update to 5.1.4- update to 5.1.3- provide php-api (#183227) - add provides for all builtin modules (Tim Jackson, #173804) - own %{_libdir}/php/pear for PEAR packages (per #176733) - add obsoletes to allow upgrade from FE4 PDO packages (#181863)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild for new libc-client soname- only build xmlreader and xmlwriter shared (#177810)- update to 5.1.2- rebuild again- rebuild for new net-snmp- enable short_open_tag in default php.ini again (#175381)- rebuilt- require net-snmp for php-snmp (#174800)- add /usr/share/pear back to hard-coded include_path (#174885)- rebuild for httpd 2.2- update to 5.1.1 - remove pear subpackage - enable pdo extensions (php-pdo subpackage) - remove non-standard conditional module builds - enable xmlreader extension- rebuilt against new openssl- pear: update to XML_RPC 1.4.4, XML_Parser 1.2.7, Mail 1.1.9 (#172528)- rebuild for new libnetsnmp- update to 5.0.5 - add fix for upstream #34435 - devel: require autoconf, automake (#159283) - pear: update to HTTP-1.3.6, Mail-1.1.8, Net_SMTP-1.2.7, XML_RPC-1.4.1 - fix imagettftext et al (upstream, #161001)- ldap: restore ldap_start_tls() function- disable RPATHs in shared extensions (#156974)- build simplexml_import_dom even with shared dom (#156434) - prevent truncation of copied files to ~2Mb (#155916) - install /usr/bin/php from CLI build alongside CGI - enable sysvmsg extension (#142988)- prevent build of builtin dba as well as shared extension- split out dba and bcmath extensions into subpackages - BuildRequire gcc-c++ to avoid AC_PROG_CXX{,CPP} failure (#155221) - pear: update to DB-1.7.6 - enable FastCGI support in /usr/bin/php-cgi (#149596)- build /usr/bin/php with the CLI SAPI, and add /usr/bin/php-cgi, built with the CGI SAPI (thanks to Edward Rudd, #137704) - add php(1) man page for CLI - fix more test cases to use -n when invoking php- rebuild for new libpq soname- bundle from PEAR: HTTP, Mail, XML_Parser, Net_Socket, Net_SMTP - snmp: disable MSHUTDOWN function to prevent error_log noise (#153988) - mysqli: add fix for crash on x86_64 (Georg Richter, upstream #32282)- build shared objects as PIC (#154195)- fix PEAR installation and bundle PEAR DB-1.7.5 package- update to 5.0.4 (#153068) - add .phps AddType to php.conf (#152973) - better gcc4 fix for libxmlrpc- BuildRequire mysql-devel >= 4.1 - don't mark php.ini as noreplace to make upgrades work (#152171) - fix subpackage descriptions (#152628) - fix memset(,,0) in Zend (thanks to Dave Jones) - fix various compiler warnings in Zend- package mysqli extension in php-mysql - really enable pcntl (#142903) - don't build with --enable-safe-mode (#148969) - use "Instant Client" libraries for oci8 module (Kai Bolay, #149873)- fix build with GCC 4- install the ext/gd headers (#145891) - enable pcntl extension in /usr/bin/php (#142903) - add libmbfl array arithmetic fix (dcb314@hotmail.com, #143795) - add BuildRequire for recent pcre-devel (#147448)- update to 5.0.3 (thanks to Robert Scheck et al, #143101) - enable xsl extension (#142174) - package both the xsl and dom extensions in php-xml - enable soap extension, shared (php-soap package) (#142901) - add patches from upstream 5.0 branch: * Zend_strtod.c compile fixes * correct php_sprintf return value usage- update for db4-4.3 (Robert Scheck, #140167) - build against mysql-devel - run tests in %check- truncate changelog at 4.3.1-1 - merge from 4.3.x package: - enable mime_magic extension and Require: file (#130276)- fix dom/sqlite enable/wx(X=`C%0$0x?4 *5> G  $ ( 4 8 ?   ( X Y  DphtmQINBFOn/0sBEADLDyZ+DQHkcTHDQSE0a0B2iYAEXwpPvs67cJ4tmhe/iMOyVMh9 Yw/vBIF8scm6T/vPN5fopsKiW9UsAhGKg0epC6y5ed+NAUHTEa6pSOdo7CyFDwtn 4HF61Esyb4gzPT6QiSr0zvdTtgYBRZjAEPFVu3Dio0oZ5UQZ7fzdZfeixMQ8VMTQ 4y4x5vik9B+cqmGiq9AW71ixlDYVWasgR093fXiD9NLT4DTtK+KLGYNjJ8eMRqfZ Ws7g7C+9aEGHfsGZ/SxLOumx/GfiTloal0dnq8TC7XQ/JuNdB9qjoXzRF+faDUsj WuvNSQEqUXW1dzJjBvroEvgTdfCJfRpIgOrc256qvDMp1SxchMFltPlo5mbSMKu1 x1p4UkAzx543meMlRXOgx2/hnBm6H6L0FsSyDS6P224yF+30eeODD4Ju4BCyQ0jO IpUxmUnApo/m0eRelI6TRl7jK6aGqSYUNhFBuFxSPKgKYBpFhVzRM63Jsvib82rY 438q3sIOUdxZY6pvMOWRkdUVoz7WBExTdx5NtGX4kdW5QtcQHM+2kht6sBnJsvcB JYcYIwAUeA5vdRfwLKuZn6SgAUKdgeOtuf+cPR3/E68LZr784SlokiHLtQkfk98j NXm6fJjXwJvwiM2IiFyg8aUwEEDX5U+QOCA0wYrgUQ/h8iathvBJKSc9jQARAQAB tEJDZW50T1MtNyBLZXkgKENlbnRPUyA3IE9mZmljaWFsIFNpZ25pbmcgS2V5KSA8 c2VjdXJpdHlAY2VudG9zLm9yZz6JAjUEEwECAB8FAlOn/0sCGwMGCwkIBwMCBBUC CAMDFgIBAh4BAheAAAoJECTGqKf0qA61TN0P/2730Th8cM+d1pEON7n0F1YiyxqG QzwpC2Fhr2UIsXpi/lWTXIG6AlRvrajjFhw9HktYjlF4oMG032SnI0XPdmrN29lL F+ee1ANdyvtkw4mMu2yQweVxU7Ku4oATPBvWRv+6pCQPTOMe5xPG0ZPjPGNiJ0xw 4Ns+f5Q6Gqm927oHXpylUQEmuHKsCp3dK/kZaxJOXsmq6syY1gbrLj2Anq0iWWP4 Tq8WMktUrTcc+zQ2pFR7ovEihK0Rvhmk6/N4+4JwAGijfhejxwNX8T6PCuYs5Jiv hQvsI9FdIIlTP4XhFZ4N9ndnEwA4AH7tNBsmB3HEbLqUSmu2Rr8hGiT2Plc4Y9AO aliW1kOMsZFYrX39krfRk2n2NXvieQJ/lw318gSGR67uckkz2ZekbCEpj/0mnHWD 3R6V7m95R6UYqjcw++Q5CtZ2tzmxomZTf42IGIKBbSVmIS75WY+cBULUx3PcZYHD ZqAbB0Dl4MbdEH61kOI8EbN/TLl1i077r+9LXR1mOnlC3GLD03+XfY8eEBQf7137 YSMiW5r/5xwQk7xEcKlbZdmUJp3ZDTQBXT06vavvp3jlkqqH9QOE8ViZZ6aKQLqv pL+4bs52jzuGwTMT7gOR5MzD+vT0fVS7Xm8MjOxvZgbHsAgzyFGlI1ggUQmU7lu3 uPNL0eRx4S1G4Jn5 gpg-pubkeyf4a80eb553a7ff4bgpg(CentOS-7 Key (CentOS 7 Official Signing Key) )-----BEGIN PGP PUBLIC KEY BLOCK----- Version: rpm-4.11.3 (NSS-3) mQINBFOn/0sBEADLDyZ+DQHkcTHDQSE0a0B2iYAEXwpPvs67cJ4tmhe/iMOyVMh9 Yw/vBIF8scm6T/vPN5fopsKiW9UsAhGKg0epC6y5ed+NAUHTEa6pSOdo7CyFDwtn 4HF61Esyb4gzPT6QiSr0zvdTtgYBRZjAEPFVu3Dio0oZ5UQZ7fzdZfeixMQ8VMTQ 4y4x5vik9B+cqmGiq9AW71ixlDYVWasgR093fXiD9NLT4DTtK+KLGYNjJ8eMRqfZ Ws7g7C+9aEGHfsGZ/SxLOumx/GfiTloal0dnq8TC7XQ/JuNdB9qjoXzRF+faDUsj WuvNSQEqUXW1dzJjBvroEvgTdfCJfRpIgOrc256qvDMp1SxchMFltPlo5mbSMKu1 x1p4UkAzx543meMlRXOgx2/hnBm6H6L0FsSyDS6P224yF+30eeODD4Ju4BCyQ0jO IpUxmUnApo/m0eRelI6TRl7jK6aGqSYUNhFBuFxSPKgKYBpFhVzRM63Jsvib82rY 438q3sIOUdxZY6pvMOWRkdUVoz7WBExTdx5NtGX4kdW5QtcQHM+2kht6sBnJsvcB JYcYIwAUeA5vdRfwLKuZn6SgAUKdgeOtuf+cPR3/E68LZr784SlokiHLtQkfk98j NXm6fJjXwJvwiM2IiFyg8aUwEEDX5U+QOCA0wYrgUQ/h8iathvBJKSc9jQARAQAB tEJDZW50T1MtNyBLZXkgKENlbnRPUyA3IE9mZmljaWFsIFNpZ25pbmcgS2V5KSA8 c2VjdXJpdHlAY2VudG9zLm9yZz6JAjUEEwECAB8FAlOn/0sCGwMGCwkIBwMCBBUC CAMDFgIBAh4BAheAAAoJECTGqKf0qA61TN0P/2730Th8cM+d1pEON7n0F1YiyxqG QzwpC2Fhr2UIsXpi/lWTXIG6AlRvrajjFhw9HktYjlF4oMG032SnI0XPdmrN29lL F+ee1ANdyvtkw4mMu2yQweVxU7Ku4oATPBvWRv+6pCQPTOMe5xPG0ZPjPGNiJ0xw 4Ns+f5Q6Gqm927oHXpylUQEmuHKsCp3dK/kZaxJOXsmq6syY1gbrLj2Anq0iWWP4 Tq8WMktUrTcc+zQ2pFR7ovEihK0Rvhmk6/N4+4JwAGijfhejxwNX8T6PCuYs5Jiv hQvsI9FdIIlTP4XhFZ4N9ndnEwA4AH7tNBsmB3HEbLqUSmu2Rr8hGiT2Plc4Y9AO aliW1kOMsZFYrX39krfRk2n2NXvieQJ/lw318gSGR67uckkz2ZekbCEpj/0mnHWD 3R6V7m95R6UYqjcw++Q5CtZ2tzmxomZTf42IGIKBbSVmIS75WY+cBULUx3PcZYHD ZqAbB0Dl4MbdEH61kOI8EbN/TLl1i077r+9LXR1mOnlC3GLD03+XfY8eEBQf7137 YSMiW5r/5xwQk7xEcKlbZdmUJp3ZDTQBXT06vavvp3jlkqqH9QOE8ViZZ6aKQLqv pL+4bs52jzuGwTMT7gOR5MzD+vT0fVS7Xm8MjOxvZgbHsAgzyFGlI1ggUQmU7lu3 uPNL0eRx4S1G4Jn5 =OGYX -----END PGP PUBLIC KEY BLOCK----- SKlocalhostpubkeyCentOS-7 Key (CentOS 7 Official Signing Key) Public Keys(none)gpg(CentOS-7 Key (CentOS 7 Official Signing Key) )gpg(f4a80eb5)4.11.34:24c6a8a7f4a80eb5-53a7ff4b4:24c6a8a7f4a80eb5-53a7ff4b?489efff35e604042709daf46fb78611fe90a75aabbe0x08bc08700x6921aa3x XE` $4 2a8CG rRfsOAJxim63CHfty5mUc5rUSnTslGYEIOCR1BeQauyPZbPDsDD9MZ1ZaSafanFv wFG6Llx9xkU7tzq+vKLoWkm4u5xf3vn55VjnSd1aQ9eQnUcXiL4cnBGoTbOWI39E cyzgslzBdC++MPjcQTcA7p6JUVsP6oAB3FQWg54tuUo0Ec8bsM8b3Ev42LmuQT5N dKHGwHsXTPtl0klk4bQk4OajHsiy1BMahpT27jWjJlMiJc+IWJ0mghkKHt926s/y mfdf5HkdQ1cyvsz5tryVI3Fx78XeSYfQvuuwqp2H139pXGEkg0n6KdUOetdZWhe7 0YGNPw1yjWJT1IhUBBgRAgAMBQJOdz3tBQkT+wG4ABIHZUdQRwABAQkQjHGNO1By 4fUUmwCbBYr2+bBEn/L2BOcnw9Z/QFWuhRMAoKVgCFm5fadQ3Afi+UQlAcOphrnJ =Eto8 -----END PGP PUBLIC KEY BLOCK----- Nw>*localhostpubkeyMySQL Release Engineering Public Keys(none)gpg(MySQL Release Engineering )gpg(5072e1f5)4.11.34:8c718d3b5072e1f5-4e773e2a4:8c718d3b5072e1f5-4e773e2a?4eff33d40da712a1e1cf06fe17a3c2fdd9898bdbb!b!s (Jaroslav Kysela) [1112200] - [alsa] hda: Don't set indep_hp flag for old AD codecs (Jaroslav Kysela) [1112200] - [alsa] Enable CONFIG_ZONE_DMA for smaller PCI DMA masks (Jaroslav Kysela) [1112200] - [alsa] pcm: Warn when buffer preallocation fails (Jaroslav Kysela) [1112200] - [alsa] ctxfi: Work around emu20k1 glitch to prevent buffered sound data loss (Jaroslav Kysela) [1112200] - [alsa] Merge memalloc code into snd-pcm module (Jaroslav Kysela) [1112200] - [alsa] Remove superfluous header inclusions in memalloc.c (Jaroslav Kysela) [1112200] - [alsa] Remove memory reservation code from memalloc helper (Jaroslav Kysela) [1112200] - [alsa] Remove memory accounting in memalloc helper (Jaroslav Kysela) [1112200] - [alsa] hda/hdmi: apply all Haswell fix-ups to Broadwell display codec (Jaroslav Kysela) [1112200] - [alsa] hda: add codec ID for Broadwell display audio codec (Jaroslav Kysela) [1112200] - [alsa] hda: add device ID for Broadwell display audio controller (Jaroslav Kysela) [1112200] - [alsa] hda: Split Thinkpad ACPI-related code (Jaroslav Kysela) [1112200] - [alsa] hda: Don't create duplicated ctls for loopback paths (Jaroslav Kysela) [1112200] - [alsa] hda: Correct AD1986A 3stack pin configs (Jaroslav Kysela) [1112200] - [alsa] hda: Add consistent tag names for firmware patch (Jaroslav Kysela) [1112200] - [alsa] hda: firmware patch code cleanup (Jaroslav Kysela) [1112200] - [alsa] hda: Increment default stream numbers for AMD HDMI controllers (Jaroslav Kysela) [1112200] - [alsa] hda: Minor code optimization for patch_realtek.c (Jaroslav Kysela) [1112200] - [alsa] compress: remove the sample rate check (Jaroslav Kysela) [1112200] - [alsa] rme9652: fix a missing comma in channel_map_9636_ds (Jaroslav Kysela) [1112200] - [alsa] cs5535audio: use named constants for pci_power_t values (Jaroslav Kysela) [1112200] - [alsa] hda: Disable Front HP jack detection on Gigabyte Z87X-UD3H (Jaroslav Kysela) [1112200] - [alsa] hiface: Fix typo in 352800 rate definition (Jaroslav Kysela) [1112200] - [alsa] usb-audio: Add a quirk for Plantronics Gamecom 780 (Jaroslav Kysela) [1112200] - [alsa] hda: Enable subwoofer on Dell Vostro 5460/5470 (Jaroslav Kysela) [1112200] - [alsa] hda: Fix wrong inclusion in Thinkpad ACPI users (Jaroslav Kysela) [1112200] - [alsa] hda: Add warning texts when codec driver Kconfig doesn't match (Jaroslav Kysela) [1112200] - [alsa] hda: Kill EXPORT_SYMBOL_HDA() (Jaroslav Kysela) [1112200] - [alsa] hda: Make CONFIG_SND_HDA_CODEC_* tristate (Jaroslav Kysela) [1112200] - [alsa] hda: Explicitly keep codec powered up in hdmi_present_sense (Jaroslav Kysela) [1112200] - [alsa] hda: Add Dell headset detection quirk for one more laptop model (Jaroslav Kysela) [1112200] - [alsa] Add SNDRV_PCM_STATE_PAUSED case in wait_for_avail function (Jaroslav Kysela) [1112200]- [misc] mei: ignore client writing state during cb completion (Prarit Bhargava) [1088953] - [misc] mei: don't use deprecated DEFINE_PCI_DEVICE_TABLE macro (Prarit Bhargava) [1088953] - [misc] mei: amthif: fix checkpatch error (Prarit Bhargava) [1088953] - [misc] mei: fix Unnecessary space after function pointer name (Prarit Bhargava) [1088953] - [misc] mei: use cl_dbg where appropriate (Prarit Bhargava) [1088953] xXU``<$(<JaL xsgbVQE@4/# ythcWRFA50$ z u i d X S G B 6 1 %    { v j e Y T H C 7 2 & !    | w k f Z U I D 8 3 ' "    } x l g [ V J E 9 4 ( #     ~ y m h \ W K F : 5 ) $     zni]XLG;6*%{oj^YMH<7+& |pk_ZNI=8,' }ql`[OJ>9-( ~rma\PK?:.) snb]QL@;/xLxLxLxLxLxLxLxLxLxLxLxLxLxLxLxLxLxLxLxLxLxLxLxLxLxLxLxL  ^J <&`.  $TX3} do3>CC)4BAT"#,K-I\4I$?HL=a't{HV4X<j`G[G\FLFzLJEx}b=)]S4&=s,_ОC.^"C,<13 a0~ I~4TM}B*| z ez32y8x4^42w Qv]Xt^s%'p \n2mrf2e1`a$e^1T]w \ Z1x8Y aX .dNW&V1U|R1HQ~zO8Ny1FM<K0%Jf1I(GF91BE>D,C@B0 Aof>0Xa=<-;U}:09}Tdg8 '87@xs605}TC4T4#30D1}T ,0,0/0-}Tq!, 3,(#+%*}T$h(@Z( #'0&}TÐ"$- q$\m#_"}TѐTJ A+ -lL@0,}T|KD+0 }T#}_4(K}TQ}' q}T~}- ̳8a'1 }T}HK j ; J4 }T}8s $/0d~$ 9}TI 4xX3X$G?d  & S} L z         x # d#6#(v89p:2OB.FIGHI@XXYlZ[\]4^sbdgelfolqtuvDwxdyztR R P|ghCmysql-community-client5.7.391.el7MySQL database client applications and toolsThis package contains the standard MySQL clients and administration tools.bjpb2-el7-13.regionaliad02.mysql2iad.oraclevcn.com?Oracle and/or its affiliatesCopyright (c) 2000, 2022, Oracle and/or its affiliates. All rights reserved. Under GPLv2 license as shown in the Description field.MySQL Release Engineering Applications/Databaseshttp://www.mysql.com/linuxx86_64{rPYH(hj /HX#b6[SE C- 8A큤bibibibibibibibibibibjb_b_bb.bb.bb.bb.bb.bb.bb.bb.bb.bb.8abebe92ed610865117bba0af51cf656a485d686e184aee3d7cc8054308733fe1e35c016cb75a7ec85d333369f6b6b1901e82184e1f0326a34e5fc3dc46e24694f926bc1dda059ce7cb9aeb0bb5732394e2ddc95b93cd3c8b04ff4770ff16b08d665f69d62bdf88812515ff9743f029b7c5d0dd7e549822cd3ffbcc59353eff4cb83a5e0f8ee3c50d1ad793c6de94878c119d9c49dc6256dde68333e40e086a404fa377a0e49b4b2a48abcbb50f9bb05004588d0d7bb716da3e611229d839a7016b5e3ea79f7a1b04f6ef0fe50d203999b1195e9f49c180e5f6ddc3051dbf71bab3224916e1ad88f5180f5643a69f8d47ae6de5f2a82d82aca27543dd713707c358ec819cb5396c60cdff41cf1434ae3b93abb7dedc1c58be6de951b7037c069199e58185206be258e4e15269e4bbf16b02b1458c7defa3f7dfce83db285c2421fe81a4689459297b0bac5f97fe89eef24dcbfc5e44e0e786ce926536bfb1d7665cc3d002d765a30ae475813d1e3f6dfd83bfd15c0da3f736c2aad427e69877c3121ed9fba56fc12e0dfafaded987c661622db0d988e02ec7a9c0de33fdcf04065fd317d084810ccfa2f7381f8d28e1180fdf96881a6adde88a4e633d1cafc8d55cf43f0915304265f4ec4f7a8167e4da90d492f65e3dea99c0d5eddd567fe42cc6a074310d81646d74fbda06cfc006a56c583052e755ffa279cfbe82777c0e9e6e7c1b85351fe8409157bf61140e1582a0ca81063e68e0be812216a868406bb2c09fd2b3a0616137b7dce6d3e1139ea2e88c0d9fbad396bbf74739169e9edfe03e7ef021b232338b567b545bd145d28913b6e9e285698af4fd1fcbf5cf3a96c153969fcc5af170a1d400543884b2ca5c00f99e12fb7e6909b2811ad85b27a579775abcc7ac55de8d1b21d042039993db127963dde980e571811fdabd8fcc6708d945d849481ed03abee1ddd1c669794791e3d83b7724ba33c8e930cf5616aefrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootmysql-community-5.7.39-1.el7.src.rpmMySQL-client(x86-64)mysqlmysql(x86-64)mysql-community-clientmysql-community-client(x86-64)@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    @ libc.so.6(xXW *$ainstant client version 12.2- Update to 7.0.20 - http://www.php.net/releases/7_0_20.php - add upstream security patches for oniguruma- Update to 7.0.20RC1- Update to 7.0.19 - http://www.php.net/releases/7_0_19.php- new sources from new tag- Update to 7.0.19RC1 - oci8 version is now 2.1.4- Update to 7.0.18 - http://www.php.net/releases/7_0_18.php- Update to 7.0.18RC1- Update to 7.0.17 - http://www.php.net/releases/7_0_17.php- Update to 7.0.17RC1- Update to 7.0.16 - http://www.php.net/releases/7_0_16.php- Update to 7.0.16RC1 (new sources)- Update to 7.0.16RC1- Update to 7.0.15 - http://www.php.net/releases/7_0_15.php- Update to 7.0.15RC1- Update to 7.0.14 - http://www.php.net/releases/7_0_14.php - disable pcre.jit everywhere as it raise AVC #1398474- disable pcre.jit everywhere as it raise AVC #1398474- Update to 7.0.14RC1- Update to 7.0.13 - http://www.php.net/releases/7_0_13.php- Update to 7.0.13RC1 - oci8 version is now 2.1.3 - update tzdata patch to v14, improve check for valid tz file- Update to 7.0.12 - http://www.php.net/releases/7_0_12.php - rebuild with new sources- Update to 7.0.12 - http://www.php.net/releases/7_0_12.php- Update to 7.0.12RC1- Update to 7.0.11 - http://www.php.net/releases/7_0_11.php- Update to 7.0.11RC1- Update to 7.0.10 - http://www.php.net/releases/7_0_10.php- rebuild with new sources- Update to 7.0.10RC1 - relax 2 date tests (failing on EL with system tzdata)- Update to 7.0.9 - http://www.php.net/releases/7_0_9.php - wddx: add upstream patch for https://bugs.php.net/72564- Update to 7.0.9RC1- own tests/doc directories for pecl packages (f24)- Update to 7.0.8 - http://www.php.net/releases/7_0_8.php- Update to 7.0.8RC1 - opcache version is now php version- Update to 7.0.7 - http://www.php.net/releases/7_0_7.php- Update to 7.0.7RC1 - oci8 version is now 2.1.1- Update to 7.0.6 - http://www.php.net/releases/7_0_6.php - rebuild for new sources- Update to 7.0.6 http://www.php.net/releases/7_0_6.php- Update to 7.0.6RC1- Fixed bug #71914 (Reference is lost in "switch")- Update to 7.0.5 http://www.php.net/releases/7_0_5.php- Update to 7.0.5RC1- adapt for F24: define %pecl_xmldir and own it- Update to 7.0.4 http://www.php.net/releases/7_0_4.php - pcre: disables JIT compilation of patterns with system pcre < 8.38- Update to 7.0.4RC1- Update to 7.0.3 http://www.php.net/releases/7_0_3.php- FPM: test build for https://bugs.php.net/62172- Update to 7.0.3RC1- Update to 7.0.2 http://www.php.net/releases/7_0_2.php- Update to 7.0.2RC1 - opcache: build with --disable-huge-code-pages on EL-6- Update to 7.0.1 http://www.php.net/releases/7_0_1.php - curl: add CURL_SSLVERSION_TLSv1_x constant (EL)- Update to 7.0.1RC1 - drop --disable-huge-code-pages build option on EL-6, but keep it disabled in default configuration - php-devel obsoletes php-pecl-jsonc-devel- EL-6 rebuild- build with --disable-huge-code-pages on EL-6- Update to 7.0.0 http://www.php.net/releases/7_0_0.php- set opcache.huge_code_pages=0 on EL-6 see https://bugs.php.net/70973 and https://bugs.php.net/70977- Update to 7.0.0RC8 - set opcache.huge_code_pages=1 on x86_64- Update to 7.0.0RC7 (retagged)- Update to 7.0.0RC7- Update to 7.0.0RC6- rebuild as retagged- Update to 7.0.0RC5 - update php-fpm.d/www.conf comments - API and Zend API are now set to 20151012- Update to 7.0.0RC4 - php-fpm: set http authorization headers- Update to 7.0.0RC3 - disable zip extension (provided in php-pecl-zip)- Update to 7.0.0RC2 - enable oci8 and pdo_oci extensions - sync php.ini with upstream php.ini-production- Update to 7.0.0RC1- update to 7.0.0beta3- update to 7.0.0beta2 - merge changes from php70-php spec file- Update to 5.6.11 http://www.php.net/releases/5_6_11.php- don't provide php-sqlite3 on EL-5 - the phar link is now correctly created - avoid issue when 2 builds run simultaneously- Update to 5.6.10 http://www.php.net/releases/5_6_10.php - opcache is now 7.0.6-dev- Update to 5.6.9 http://www.php.net/releases/5_6_9.php- Update to 5.6.8 http://www.xXWh@Ƀ$YɃʃȃ.0~DEV.20190520-1Remi Collet - 7.3.6~RC1-2Remi Collet - 7.3.6~RC1-1Remi Collet - 7.3.5-2Remi Collet - 7.3.5-1Remi Collet - 7.3.5~RC1-1Remi Collet - 7.3.4-3Remi Collet - 7.3.4-2Remi Collet - 7.3.4-1Remi Collet - 7.3.4~RC1-2Remi Collet - 7.3.4~RC1-1Remi Collet - 7.3.3-1Remi Collet - 7.3.3~RC1-2Remi Collet - 7.3.3~RC1-1Remi Collet - 7.3.2-3Remi Collet - 7.3.2-2Remi Collet - 7.3.2-1Remi Collet - 7.3.2~RC1-1Remi Collet 7.3.1-3Remi Collet - 7.3.1-2Remi Collet - 7.3.1-1Remi Collet - 7.3.1~RC1-1Remi Collet - 7.3.0-1Remi Collet - 7.3.0~rc6-1Remi Collet - 7.3.0~rc5-1Remi Collet - 7.3.0~rc4-2Remi Collet - 7.3.0~rc4-1Remi Collet - 7.3.0~rc3-1Remi Collet - 7.3.0~rc2-1Remi Collet - 7.3.0~rc1-1Remi Collet - 7.3.0~beta3-3Remi Collet - 7.3.0~beta3-2Remi Collet - 7.3.0~beta3-1Remi Collet - 7.3.0~beta2-1Remi Collet - 7.3.0~alpha4-1Remi Collet - 7.3.0~alpha3-1Remi Collet - 7.3.0~alpha2-2Remi Collet - 7.3.0~alpha2-1Remi Collet - 7.3.0~alpha1-1Remi Collet - 7.2.7~RC1-1Remi Collet - 7.2.6-1Remi Collet - 7.2.6~RC1-2Remi Collet - 7.2.6~RC1-1Remi Collet - 7.2.5-1Remi Collet - 7.2.5~RC1-1Remi Collet - 7.2.4-2Remi Collet - 7.2.4-1Remi Collet - 7.2.4~RC1-2Remi Collet - 7.2.4~RC1-1Remi Collet - 7.2.3-2Remi Collet - 7.2.3-1Remi Collet - 7.2.3~RC1-3Remi Collet - 7.2.3~RC1-2Remi Collet - 7.2.2-1Remi Collet - 7.2.2~RC1-1Remi Collet - 7.2.1-1Remi Collet - 7.2.1~RC1-2Remi Collet - 7.2.1~RC1-1Remi Collet - 7.2.0-1Remi Collet - 7.2.0-0.31.RC6Remi Collet - 7.2.0-0.30.RC5Remi Collet - 7.2.0-0.29.RC4Remi Collet - 7.2.0-0.28.RC4Remi Collet - 7.2.0-0.27.RC3Remi Collet - 7.2.0-0.26.RC3Remi Collet - 7.2.0-0.25.RC3Remi Collet - 7.2.0-0.24.RC2Remi Collet - 7.2.0-0.23.RC2Remi Collet - 7.2.0-0.22.RC1Remi Collet - 7.2.0-0.21.RC1Remi Collet - 7.2.0-0.19.20170827.c22cda5Remi Collet - 7.2.0-0.18.20170828.cc57774Remi Collet - 7.2.0-0.17.20170822.3fff74aRemi Collet - 7.2.0-0.16.beta3Remi Collet - 7.2.0-0.15.beta2Remi Collet - 7.2.0-0.14.beta2Remi Collet - 7.2.0-0.13.beta1Remi Collet - 7.2.0-0.12.20170611.249f75eRemi Collet - 7.2.0-0.11.alpha3Remi Collet - 7.2.0-0.9.alpha2Remi Collet - 7.2.0-0.8.alpha1Remi Collet - 7.2.0-0.7.20170602.a86c87dRemi Collet - 7.2.0-0.6.20170529.37a16a3Remi Collet - 7.2.0-0.5.alpha0Remi Collet - 7.2.0-0.4.20170516.0722a01Remi Collet - 7.2.0-0.3.20170504.5af997eRemi CxXXh$t.com> - 5.1.2-4.1Joe Orton 5.1.2-4Joe Orton 5.1.2-3Joe Orton 5.1.2-2Joe Orton 5.1.1-8Joe Orton 5.1.1-7Joe Orton 5.1.1-6Jesse Keating Joe Orton 5.1.1-5Joe Orton 5.1.1-4Joe Orton 5.1.1-3Joe Orton 5.1.1-2Tomas Mraz 5.0.5-6Joe Orton 5.0.5-5Joe Orton 5.0.5-4Joe Orton 5.0.5-3Joe Orton 5.0.4-11Joe Orton 5.0.4-10Joe Orton 5.0.4-9Joe Orton 5.0.4-8Joe Orton 5.0.4-7Joe Orton 5.0.4-6Joe Orton 5.0.4-5Joe Orton 5.0.4-4Joe Orton 5.0.4-3Joe Orton 5.0.4-2Joe Orton 5.0.4-1Joe Orton 5.0.3-5Joe Orton 5.0.3-4Joe Orton 5.0.3-3Joe Orton 5.0.3-2Joe Orton 5.0.3-1Joe Orton 5.0.2-8Joe Orton 5.0.2-7Joe Orton 5.0.2-6Joe Orton 5.0.2-5Joe Orton 5.0.2-4Joe Orton 5.0.1-4Joe Orton 5.0.1-3Joe Orton 5.0.1-2Joe Orton 5.0.1-1Tom Callaway Tom Callaway - Fix filter bypass in filter_var FILTER_VALIDATE_URL CVE-2024-5458- use oracle client library version 21.13 on x86_64, 19.19 on aarch64 - Fix __Host-/__Secure- cookie bypass due to partial CVE-2022-31629 fix CVE-2024-2756 - Fix password_verify can erroneously return true opening ATO risk CVE-2024-3096- use oracle client library version 21.11 on x86_64, 19.19 on aarch64 - use official Oracle Instant Client RPM- Fix Security issue with external entity loading in XML without enabling it GHSA-3qrf-m4j2-pcrr CVE-2023-3823 - Fix Buffer mismanagement in phar_dir_read() GHSA-jqcx-ccgc-xwhv CVE-2023-3824 - move httpd/nginx wants directive to config files in /etc- fix possible buffer overflow in date - define %php73___phpize and %php73___phpconfig- Fix Missing error check and insufficient random bytes in HTTP Digest authentication for SOAP GHSA-76gg-c692-v2mw CVE-2023-3247 - use oracle client library version 21.10- fix #81744: Password_verify() always return true with some hash CVE-2023-0567 - fix #81746: 1-byte array overrun in common path resolve code CVE-2023-0568 - fix DOS vulnerability when parsing multipart request body CVE-2023-0662 - add dependency on pcre2 minimal version- pdo: fix #81740: PDO::quote() may return unquoted string CVE-2022-31631 - use oracle client library version 21.8- hash: fix #81738: buffer overflow in hash_update() on long parameter. CVE-2022-37454- phar: fix #81726 DOS when using quine gzip file. CVE-2022-31628 - core: fix #81727 Don't mangle HTTP variable names that clash with ones that have a specific semantic meaning. CVE-2022-31629 - use oracle client library version 21.7- use oracle client library version 21.6 - mysqlnd: fix #81719: mysqlnd/pdo password buffer overflow. CVE-2022-31626 - pgsql: fix #81720: Uninitialized array in pg_query_params(). CVE-2022-31625 - pcre: fix default options for pcre >= 10.38- retrieve tzdata version - use oracle client library version 21.5- Update to 7.3.33 - http://www.php.net/releases/7_3_33.php- Update to 7.3.32 - http://www.php.net/releases/7_3_32.php- fix PHP-FPM oob R/W in root process leading to priv escalation CVE-2021-21703 - use libicu version 69- Update to 7.3.31 - http://www.php.net/releases/7_3_31.php - use oracle client library version 21.3- Update to 7.3.30 - http://www.php.net/releases/7_3_30.php- Update to 7.3.29 - http://www.php.net/releases/7_3_29.php- fix snmp extension build with net-snmp withoxpXVUG$WGHFpstream release.- Add location of man pages.- Upstream release.- Upstream release.- Upstream release.- Add zlib-devel to buildreq; missing from crash-devel - Process testsuite .stp files for #!stap->#!/usr/bin/stap- Add crash-devel buildreq to build staplog.so crash(8) module. - Many robustness & functionality improvements:- Correct Source to point to location contain code.- Bumped version, added libcap-devel BuildRequires.- Fix Requires and BuildRequires for sqlite.- Many robustness improvements: 1117, 1134, 1305, 1307, 1570, 1806, 2033, 2116, 2224, 2339, 2341, 2406, 2426, 2438, 2583, 3037, 3261, 3282, 3331, 3428 3519, 3545, 3625, 3648, 3880, 3888, 3911, 3952, 3965, 4066, 4071, 4075, 4078, 4081, 4096, 4119, 4122, 4127, 4146, 4171, 4179, 4183, 4221, 4224, 4254, 4281, 4319, 4323, 4326, 4329, 4332, 4337, 4415, 4432, 4444, 4445, 4458, 4467, 4470, 4471, 4518, 4567, 4570, 4579, 4589, 4609, 4664- An emergency / preliminary refresh, mainly for compatibility with 2.6.21-pre kernels.- Many changes, see NEWS file.- Added 'systemtap-runtime' subpackage.- PRs 2669, 2913- PRs 2627, 2520, 2228, 2645- PRs 2511 2453 2307 1813 1944 2497 2538 2476 2568 1341 2058 2220 2437 1326 2014 2599 2427 2438 2465 1930 2149 2610 2293 2634 2506 2433- Many changes, affected PRs include: 2068, 2293, 1989, 2334, 1304, 2390, 2425, 953.- PRs 1916, 2205, 2142, 2060, 1379- Many changes, affected PRs include: 2056, 1144, 1379, 2057, 2060, 1972, 2140, 2148- Fixed build with gcc 4.1, various tapset changes.- elfutils update, build changes- Many fixes and improvements: 1425, 1536, 1505, 1380, 1329, 1828, 1271, 1339, 1340, 1345, 1837, 1917, 1903, 1336, 1868, 1594, 1564, 1276, 1295- Many fixes and improvements: PRs 1344, 1260, 1330, 1295, 1311, 1368, 1182, 1131, 1332, 1366, 1456, 1271, 1338, 1482, 1477, 1194.- Many fixes and improvements since 0.2.2; relevant PRs include: 1122, 1134, 1155, 1172, 1174, 1175, 1180, 1186, 1187, 1191, 1193, 1195, 1197, 1205, 1206, 1209, 1213, 1244, 1257, 1258, 1260, 1265, 1268, 1270, 1289, 1292, 1306, 1335, 1257- Bump version.- Bump version.- Add directory /var/cache/systemtap - Add stp_check to /usr/libexec/systemtap- New version 0.2.1, various fixes.- New version 0.2, requires elfutils 0.111- Clean up spec file, build bundled elfutils.- Set Version to use version from autoconf. - Fix up some of the path names. - Add Requires and BuildRequires.- Initial creation of RPM. 4.0-13.el74.0-13.el7dtracesdt-config.hsdt.hmacros.systemtapsystemtap-sdt-devel-4.0AUTHORSNEWSREADMEsystemtap-sdt-devel-4.0COPYINGdtrace.1.gz/usr/bin//usr/include/sys//usr/lib/rpm/macros.d//usr/share/doc//usr/share/doc/systemtap-sdt-devel-4.0//usr/share/licenses//usr/share/licenses/systemtap-sdt-devel-4.0//usr/share/man/man1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuPython script, ASCII text executableASCII textC++ source, ASCII textdirectoryUTF-8 Unicode texttroff or preprocessor input, ASCII text (gzip compressed data, from Unix, max compression)R?+_K=$ƨkHF?3'fYq%aQ<}$!2PJFQ&?P C:T|2H]=>z'uRJctU`]2jx`*w_;#hU ~/ -oo Eh&FnaZEhLR8۞78U+~OˮXTwڂ%'ET# Y.(N7j2=28g3EO&g&TX<߸m] ՃyU fey=ohMi82r"=,ahݷ5ԈxXWXs$, 2.0.10-14Jiri Popelka - 2.0.10-13Daniel Mach - 2.0.10-12Thomas Woerner - 2.0.10-11Daniel Mach - 2.0.10-10Thomas Woerner - 2.0.10-9Tom Callaway - 2.0.10-8Fedora Release Engineering - 2.0.10-7Fedora Release Engineering - 2.0.10-6Tom Callaway - 2.0.10-5Thomas Woerner - 2.0.10-4Fedora Release Engineering - 2.0.10-3Tom Callaway - 2.0.10-2Tom Callaway - 2.0.10-1Fedora Release Engineering - 2.0.9-6Tom "spot" Callaway - 2.0.9-5Thomas Woerner - 2.0.9-4Thomas Woerner - 2.0.9-3Tom "spot" Callaway - 2.0.9-2Tom "spot" Callaway - 2.0.9-1Fedora Release Engineering - 2.0.8-7Fedora Release Engineering - 2.0.8-6Fedora Release Engineering - 2.0.8-5Tom "spot" Callaway 2.0.8-4Tom "spot" Callaway 2.0.8-3Tom "spot" Callaway 2.0.8-2Tom "spot" Callaway 2.0.8-1Tom "spot" Callaway 2.0.8-0.8.rc3Tom "spot" Callaway 2.0.8-0.1.rc3Christian Iseli 2.0.8-0.7.rc2Tom "spot" Callaway 2.0.8-0.6.rc2Tom "spot" Callaway 2.0.8-0.3.rc2Tom "spot" Callaway 2.0.8-0.2.rc2Tom "spot" Callaway 2.0.8-0.1.rc2Tom "spot" Callaway 2.0.8-0.5.rc1Tom "spot" Callaway 2.0.8-0.4.rc1Tom "spot" Callaway 2.0.8-0.3.rc1Tom "spot" Callaway 2.0.8-0.2.rc1Tom "spot" Callaway 2.0.8-0.1.rc1Tom "spot" Callaway 2.0.6-7Tom "spot" Callaway 2.0.6-6Tom "spot" Callaway 2.0.6-5Tom "spot" Callaway 2.0.6-4Tom "spot" Callaway 2.0.6-3Dag Wieers - 2.0.6-2Dag Wieers - 2.0.6-2Dag Wieers - 2.0.6-1- Fix for potentially stale lock files (RHBZ#1495893)- Backported lockdirfix to use (/var)/run from Fedora (RHBZ#1346376)- Fixed persmissions of ebtables.service (RHBZ#1288586) - Added upstream patch to add noflush option to ebtables-restore (RHBZ#1334271)- do not eviscerate -fstack-protector(-strong) from CFLAGS (#1070801)- Mass rebuild 2014-01-24- fixed rebuild problem, using MY_CFLAGS from latest fedora package (RHBZ#1048855)- Mass rebuild 2013-12-27- fixed missing systemd unit file (RHBZ#818953) merged fedora patches from Tom Callaway - fixed NETWORK test in the init script (RHBZ#1026784) - fixed needed rpmdiff failures (RHBZ#883988)- add audit module- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- update to 2.0.10-4 (upstream numbering is goofy) - fix missing symbol issue with extension modules (bz810006)- replaced ebtables-save perl script by bash script to get rid of the perl requirement- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- update to 2.0.10-2- update to 2.0.10-1- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 2.0.9-2- moved ebtables modules to /lib[64]/ebtables (rhbz#558886)- fixed init script to be lsb conform (rhbz#536828) - fixed download link according to package review- fix source0 url- update to 2.0.9- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Autorebuild for GCC 4.3- bump to 2.0.8-2 from upstream x`XS`t}}$m}}~}|}ystem-releasesystem-release(releasever)    config(centos-release)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)7-9.2009.2.el7.centos3.0.4-14.6.0-14.0-15.2-14.11.3dcp@^]m@[[ @[l,[dC[b@[b@ZK@ZZI@ZDYXX=mX V^@V]V\:@VY@VXEU@UF@U @T-@S@SS@SQ@Sh@S-S9@SJohnny Hughes Pablo Greco Pablo Greco Pablo Greco Anssi Johansson Pablo Greco Pablo Greco Pablo Greco Johnny Hughes Pablo Greco Johnny Hughes Pablo Greco Fabian Arrotin Johnny Hughes Fabian Arrotin Johnny Hughes Fabian Arrotin Fabian Arrotin Johnny Hughes Fabian Arrotin Fabian Arrotin Fabian Arrotin Karanbir Singh Karanbir Singh Karanbir Singh Karanbir Singh Karanbir Singh Karanbir Singh Karanbir Singh Karanbir Singh Karanbir Singh Karanbir Singh 7.0.el7.0.140617.3Karanbir Singh 7.0.el7.0.140614.2Karanbir Singh 7-0.el7- Update for 7.9.2009 and EOL - EOL is 30 June 2024- Add rootfs-expand to aarch64 - Create generic kvariant in aarch64 if it doesn't exist (for new kernel repos) - Own kvariant var in armhfp and aarch64 - Backport move of /etc/os-release to /usr/lib/os-release (ngompa) - Spec file cleanup (carlwgeorge) - Update to 7.8- Own yum vars - Generate yum vars at build time - Remove dist_suffix - Fix autorelabel preset - Fix tuned profile in system-release-cpe - Set aarch64 tuned profile to server - Update to 7.7- Update to 7.6 - Fix vault repos- Point AltArch URLs to mirrorlist.c.o instead of mirror.c.o- Enable ostree-remount in presets - Include power9 as a separate ppc64le arch- Unified tarball for all arches, so it can be built from the same src.rpm- Sync version and fixes with centos-release - Unified spec for all arches- Post Trans for contentdir- armhfp: Require extlinux-bootloader now that update-boot was obsoleted- Bump Release for 1804- armhfp: Update rootfs-expand to detect rootfs - armhfp: Obsolete update-boot - armhfp: Remove old versions of rootfs-expand- armhfp: Fixed the post scriptlet to detect correctly rpi2/rpi3 with 4.9 kernel- Bump Release for 1708- armhfp: Added rootfs-expand and update-boot tools for armhfp- Bump Release for 1611- armhfp: Using a new kvariant yum var to point to correct kernel repo path- armhfp: Fixed the definitive altarch path for altarch/armhfp- Bump Release for 1511 - Add CentOS-Media.repo and put CentOS-CR.repo in the tarball, then removed patch1000- armhfp: Defaulting to normal repositories now (release approaching)- armhfp: Overriding the releasever yum var, as pkg name isn't centos-release- armhfp: initial release for the AltArch armhfp userland- rework upstream communication - re-establish redhat-release as a symlink from centos-release- dont auto enable the initial-setup tui mode- Bump Release for 1503 - add ABRT specific content to os-release - split redhat-release from centos-release- Include the CR repo for upcoming 7.1 release ( and beyond )- add a yum var to route mirrorlist accurately - add CentOS-fastrack repo - Trim the CentOS-Debug-7 key - rename the Debug repo to base-debug so yum-utils can consume easier- add CentOS-7 Debug rpm key- Roll in the final name change conversation results - Stage for release content - Add yum repos - Add distro keys ( incomplete )- add a macro to macros.dist to indicate xtXVpI$YIJHFrank Ch. Eigler - 3.1-1Frank Ch. Eigler - 3.0-7Frank Ch. Eigler - 3.0-6Frank Ch. Eigler - 3.0-5Frank Ch. Eigler - 3.0-4Frank Ch. Eigler - 3.0-3Frank Ch. Eigler - 3.0-2Frank Ch. Eigler - 3.0-1Frank Ch. Eigler - 2.8-10Frank Ch. Eigler - 2.8-9Frank Ch. Eigler - 2.8-8Frank Ch. Eigler - 2.8-7Frank Ch. Eigler - 2.8-6Frank Ch. Eigler - 2.8-5Frank Ch. Eigler - 2.8-3Frank Ch. Eigler - 2.8-1Frank Ch. Eigler - 2.7-2Frank Ch. Eigler - 2.6-9Frank Ch. Eigler - 2.6-8Frank Ch. Eigler - 2.6-7Frank Ch. Eigler - 2.6-6Frank Ch. Eigler - 2.6-5Frank Ch. Eigler - 2.6-3Josh Stone - 2.6-2Josh Stone - 2.6-1Josh Stone - 2.4-16Josh Stone - 2.4-15Jonathan Lebon - 2.4-14Jonathan Lebon - 2.4-13Jonathan Lebon - 2.4-12Jonathan Lebon - 2.4-11Jonathan Lebon - 2.4-10Jonathan Lebon - 2.4-9Daniel Mach - 2.4-8Jonathan Lebon - 2.4-7Frank Ch. Subbackportmeister Eigler - 2.4-6Jonathan Lebon - 2.4-5Jonathan Lebon - 2.4-4Jonathan Lebon - 2.4-3Daniel Mach - 2.4-2Frank Ch. Eigler - 2.4-1Jonathan Lebon Frank Ch. Eigler - 2.3-1Frank Ch. Eigler - 2.2.1-1Frank Ch. Eigler - 2.2-1Serguei Makarov - 2.1-1Josh Stone - 2.0-1Peter Robinson Frank Ch. Eigler - 1.8-1Frank Ch. Eigler - 1.7-1David Smith - 1.6-2Stan Cox - 1.6-1Stan Cox - 1.5-1Frank Ch. Eigler - 1.4-1Josh Stone - 1.3-1Frank Ch. Eigler - 1.2-1David Smith - 1.1-1Josh Stone - 1.0-1Josh Stone - 0.9.9-1Josh Stone - 0.9.8-1Josh Stone - 0.9.7-1Josh Stone - 0.9.5-1Will Cohen - 0.9-2Frank Ch. Eigler - 0.9-1Frank Ch. Eigler - 0.8-1Frank Ch. Eigler - 0.7-1Frank Ch. Eigler - 0.6.1-3Frank Ch. Eigler - 0.6.1-1Will Cohen - 0.6-2David Smith - 0.6-1Will Cohen - 0.5.14-2Frank Ch. Eigler - 0.5.14-1Frank Ch. Eigler - 0.5.13-1Frank Ch. Eigler - 0.5.12-1David Smith - 0.5.10-1Roland McGrath - 0.5.9-1Roland McGrath - 0.5.8-1Frank Ch. Eigler - 0.5.7-1Roland McGrath - 0.5.5-1Frank Ch. Eigler - 0.5.4-1Roland McGrath - 0.5.3-1Roland McGrath - 0.5.2-1Roland McGrath - 0.5.1-1Frank Ch. Eigler - 0.5-1Roland McGrath - 0.4.2-1Roland McGrath - 0.4.1-1Frank Ch. Eigler Frank Ch. Eigler Martin Hunt - 0.2.2-1Roland McGrath - 0.2.1-1Roland McGrath - 0.2-1Roland McGrath Martin Hunt Will Cohen - rhbz1810216: fix ftrace tapset (autoconf)- rhbz1808185: uretprobe blacklist for xPdXW@0m $}m n l om> 1.39-1Chip Turner 1.37-1Chip Turner 1.32-6Chip Turner Chip Turner Chip Turner Chip Turner Trond Eivind Glomsrød 1.30-1Trond Eivind Glomsrød 1.28-1Tim Powers Trond Eivind Glomsrød 1.23-2Trond Eivind Glomsrød 1.23-1Tim Powers Trond Eivind Glomsrød 1.21-2Trond Eivind Glomsrød 1.21-1Chip Turner Trond Eivind Glomsrød 1.201-2Trond Eivind Glomsrød 1.201-1Tim Powers Trond Eivind Glomsrød 1.20-1Trond Eivind Glomsrød Trond Eivind Glomsrød Trond Eivind Glomsrød Trond Eivind Glomsrød Trond Eivind Glomsrød Tim Powers - Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- Add a security warning about use of RPC::PlClient (bug #1030578)- 1.627 bump- 1.626 bump- 1.625 bump, perl5.17 fixes- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- 1.623 bump- Disable Coro properly- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Perl 5.16 re-rebuild of bootstrapped packages- Conditionalize usage of Coro, which is used in experimental module and MLDB and SLQ::Statement.- Perl 5.16 rebuild- 1.622 bump- 1.620 bump - Removing some perl-provided explicit dependencies- 810370 apply Paul's bootstrap macro- Build-require optional Test::Pod::Coverage- 1.618 bump- 1.617 bump - Modernize spec - Remove now obsolete perl(DBI) Provides- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Perl mass rebuild- Adapt dependency filtering for rpmbuild >= 4.9.- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- 1.616 version bump- Rebuilt for gcc bug 634757- 1.615 version bump- 1.614 version bump- 1.613 version bump- 1.611 bump - Add BuildRequires perl(RPC::PlClient) to cover some optional tests - Fix indentation- Mass rebuild with perl-5.12.0- rebuild against perl 5.10.1- provide versioned perl(DBI)- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- new upstream version - drop unneeded build patch - move the iconv to convert the source- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- update- Rebuild for perl 5.10 (again)- Autorebuild for GCC 4.3- rebuild for new perl- Update to latest CPAN version: 1.601 - Fix some issues from package review: - patch to change #! line in script - make script executable - fix requires and buildrequires- Rebuild- Update to latest CPAN version: 1.58- Update to latest CPAN version: 1.56 - Move the filter requires step into %prep - Remove very old patch (for perl 5.8.1) - Fix a couple of rpmlint issues (non-UTF8 manpage and script with incorrect shebang line- Upgrade to latest CPAN version: 1.53- Upgrade to 1.52 for bug #202310- Upgrade to 1.51- rebuild- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild for new perl-5.8.8 / gcc / glibc- upgrade to 1.50- rebuilt for new gcc- rebuilt for new gcj- (#154762) - License information: GPL or Artistic - Removed the Time::HiRes building requirement (see Changes) - Removed the empty .bs file - Corrected file permissions- filter perl(Apache) (#153673)- spec file cleanup (#153164)- 1.48- rebuilt- rebuilt- update to 1.40- update to 1.39- upgrade to 1.37- add buildrequires on perl-Time-HiRes- update dependency filter to remove dependency on perl(Apache) that - crept in (#82927)- version bump and rebuild- don't use rpm internal dep generator- rebuild- 1.30.- 1.28 - Building it also fixes #66304- automated rebuild- Tweak dependency finder - filter out a dependency found within the doc section of a module- 1.23 - Some changes to integrate with new Perl - Update URL- auxSXXW$K?d # ?I{ B  @   i    ?   ( L9 099() *+,-89p:b=>?@DG(H|IXY\]l^{bdrewfzl|_ 7_ ghCphp71-php-fpm7.1.3329.el7.remiPHP FastCGI Process ManagerPHP-FPM (FastCGI Process Manager) is an alternative PHP FastCGI implementation with some additional features useful for sites of any size, especially busier sites.f`builder.remirepo.netKRemi's RPM repository #StandWithUkrainePHP and Zend and BSD and MIT and ASL 1.0 and NCSARemi ColletDevelopment/Languageshttp://www.php.net/linuxx86_64# Add the "apache" user (to avoid pulling httpd in our dep) getent group apache >/dev/null || \ groupadd -g 48 -r apache getent passwd apache >/dev/null || \ useradd -r -u 48 -g apache -s /sbin/nologin \ -d /usr/share/httpd -c "Apache" apache exit 0 if [ $1 -eq 1 ] ; then # Initial installation systemctl preset php71-php-fpm.service >/dev/null 2>&1 || : fi if [ $1 -eq 0 ] ; then # Package removal, not upgrade systemctl --no-reload disable php71-php-fpm.service > /dev/null 2>&1 || : systemctl stop php71-php-fpm.service > /dev/null 2>&1 || : fi systemctl daemon-reload >/dev/null 2>&1 || : if [ $1 -ge 1 ] ; then # Package upgrade, not uninstall systemctl try-restart php71-php-fpm.service >/dev/null 2>&1 || : fi # Handle upgrading from SysV initscript to native systemd unit. # We can tell if a SysV version of php-fpm was previously installed by # checking to see if the initscript is present.<Lr(JxPIw<8<(((((A큤AA큤A큤A큤AAAAAf`f`f`f`f`f`f`f`f`f`f`f`f`f``f`f`f`f`f`f`f`e77841519c4be6886da8faa974e2d0310faaa0f7ecae7f4afee9fb1de7135d5a016e4e810f7f80496b0a1252493c6d35012f21980596b7a596fae8376753e2dab44cd6535f804fd450e4d896399da9387f52393d9c074fbdb4ce2a5ede60d4fadb3971f2329391ee2f0e7542f65f33becbfb87321ba4c973694ebe41f70b545a4399f55b3c8c181a4c116d9ed25394dfb57efc5ef736549b54adc6bdfe998eef13adfd85c684190b1d554e95eb069423c1bcaf01c522d448df80bb54938fdb86fb32489771103885827ac4b0c5fec8924e1c8134363226b616387afa6486ab05e4c6e08b44a457289d2f39e623f621502ed5ba470d1558bed4b525deb025af2128b9b14401f49784efd2246b32f745c2cd998f4f425be677f29e02a33e68bfedd8371f6aa1316b064b84193a08f6d71198b5580af1a0cdc47cec2b3e2452d7105476fb57b590668a0ce5d6cbf6c38d9c7b3b8971bd9c5607641b46d817ffbf16rootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootapacherootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootapacheapacheapacherootrootphp71-php-7.1.33-29.el7.remi.src.rpmphp71-x@CX Wh$hFh?Hd   ]1= I_sy      Tf(8N9 N:KNB GHHXIhXlYxZ [ \]^(bxd=eBfElGt`upvwxy(,X\l_ _ *TX\g`hdCphp-xmlrpc7.0.3342.el7.remiA module for PHP applications which use the XML-RPC protocolThe php-xmlrpc package contains a dynamic shared object that will add support for the XML-RPC protocol to PHP.f`builder.remirepo.netRemi's RPM repository #StandWithUkrainePHP and BSDRemi ColletDevelopment/Languageshttp://www.php.net/linuxx86_6455IIf`f`f`f`79ad9466318efa372b33cff791d0c57f6b0fabe78fcbe71e0c33337a65a88ed179ad9466318efa372b33cff791d0c57f6b0fabe78fcbe71e0c33337a65a88ed1c101c841c8ab7130810173e1b9c8ac4b17a7e8e9412c6d42451d7a435d79e75e31d4ce20cccde547afc4ffa2816cf9f6bdeab45ca020e721a3b72b6a4101a6d8rootrootrootrootrootrootrootrootphp-7.0.33-42.el7.remi.src.rpmconfig(php-xmlrpc)php-xmlrpcphp-xmlrpc(x86-64)@@@@@@@@@@@@   @ config(php-xmlrpc)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libdl.so.2()(64bit)libm.so.6()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libxml2.so.2()(64bit)libz.so.1()(64bit)php-xml(x86-64)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)7.0.33-42.el7.remi7.0.33-42.el7.remi3.0.4-14.6.0-14.0-15.2-14.11.3f_f@dE@d@dq@cwcc2b=aKapa'@`ٹ`N@`@_@_s!_)M^^^p^K^)]@]@]fl]@1@]G@\"\8\N\\~d\}@\5@\[@[M@Z@ZZH@ZKt@Z&@Z@Z@Y+@Yܶ@YA@Yo@Y@Y@YW@Y@YYYm@Y[@YJ_Y6@Y$$@Y@Y@X:@X@XۡX@Xf@X@X@XX~@Xn5@XGXEVX5X!@XWw@Ww@W_@W;W@WWWWgW|Wu Wj}WXWEW4p@W!@W W @W@VVJVxVVŲ@VVT@VvVVVqR@VhVbV`.V]V\:@VUVD@VC-V0VCV@V UYUUd@UU@UVUyx@Uyx@UUU/@U'@U @T!T@TTTp@T5Tw@ThTd@TR(@TR(@TPTO@T?@T.T%U@T"@T@TTk@SSSS@SFS]SSSSS@S@S[S @SsZShSd@SFSE6@S2@S&S L@Sz@S @S S?S@SK@RR@R@RR=R=R@R1@RSR@R@Rv@R0@RiR@R|@Rz/@Rw@Rw@Rt@Rt@Rm@R].@R@-@R:@R @RRZ@RR@QMQdQQQ4QQQQ@QyQJQQ@Qm@Q>@Q{Q{QyQyQu&@Qo@QfQeT@Q]k@QT0QP<@QIQGQAQ9Q/FQ& @Q@Q.QQ @Qh@PPP@P!@PCPZPqP @P @P @PPPP@PPPe@PP@P@PPPP@P@PPP@P)PP@PnPmz@Pmz@PiPiPe@P`K@PYPYPYPYPYPXb@PWPS@PQPDP@@P2&P,PkP H@O$O0@O@O O؀O]@O@O\@Os@O@O@OvOvOqOpZ@OP@O?O-O"O!@@OOO@O@OO?@NNaN@NN@N@N@Nh@NbRemi Collet - 7.0.33-42Remi Collet - 7.0.33-41Remi Collet - 7.0.33-40Remi Cx2XWV$P.com> - 8.14.5-14Jaroslav Škarvada - 8.14.5-13Fedora Release Engineering - 8.14.5-12Jaroslav Škarvada - 8.14.5-11Jaroslav Škarvada - 8.14.5-10Jaroslav Škarvada - 8.14.5-9Jaroslav Škarvada - 8.14.5-8Jaroslav Škarvada - 8.14.5-7Jaroslav Škarvada - 8.14.5-6Jaroslav Škarvada - 8.14.5-5Jaroslav Škarvada - 8.14.5-4Jóhann B. Guðmundsson - 8.14.5-3Paul Howarth - 8.14.5-2Jaroslav Škarvada - 8.14.5-1Jaroslav Škarvada - 8.14.4-21Fedora Release Engineering - 8.14.4-20Jaroslav Škarvada - 8.14.4-19Jaroslav Škarvada - 8.14.4-18Jaroslav Škarvada - 8.14.4-17Jaroslav Škarvada - 8.14.4-16jkeating - 8.14.4-15Jaroslav Škarvada - 8.14.4-14Jaroslav Škarvada - 8.14.4-13Jaroslav Škarvada - 8.14.4-12Jaroslav Škarvada - 8.14.4-11Jaroslav Škarvada - 8.14.4-10Jaroslav Škarvada - 8.14.4-9Jaroslav Škarvada - 8.14.4-8Jaroslav Škarvada - 8.14.4-7Jaroslav Škarvada - 8.14.4-6Jaroslav Škarvada - 8.14.4-5Jaroslav Škarvada - 8.14.4-4Jaroslav Škarvada - 8.14.4-3Jaroslav Škarvada - 8.14.4-2Jaroslav Škarvada - 8.14.4-1Robert Scheck 8.14.3-10Miroslav Lichvar 8.14.3-9Tomas Mraz - 8.14.3-8Tomas Mraz - 8.14.3-7Fedora Release Engineering - 8.14.3-6Fedora Release Engineering - 8.14.3-5Miroslav Lichvar 8.14.3-4Miroslav Lichvar 8.14.3-3Miroslav Lichvar 8.14.3-2Thomas Woerner 8.14.3-1Tom "spot" Callaway 8.14.2-5Dennis Gilmore 8.14.2-4Thomas Woerner 8.14.2-3Release Engineering - 8.14.2-2Thomas Woerner 8.14.2-1Thomas Woerner 8.14.1-4.2Thomas Woerner 8.14.1-4.1Thomas Woerner 8.14.1-4Thomas Woerner 8.14.1-3Thomas Woerner 8.14.1-2Thomas Woerner 8.14.1-1.1Thomas Woerner 8.14.1-1Thomas Woerner 8.14.0-1Florian La Roche Thomas Woerner 8.13.8-3.1Thomas Woerner 8.13.8-3Florian La Roche Thomas Woerner 8.13.8-1Thomas Woerner 8.13.7-3.1Thomas Woerner 8.13.7-3Jesse Keating - 8.13.7-2.1Thomas Woerner 8.13.7-2Thomas Woerner 8.13.7-1Thomas Woerner 8.13.6-1Thomas Woerner 8.13.5-3Jesse Keating - 8.13.5-2.2.1Jesse Keating - 8.13.5-2.2Jesse Keating Tomas Mraz 8.13.5-2Tomas Mraz Thomas Woerner 8.13.5-1Thomas Woerner 8.13.4-2Thomas Woerner 8.13.4-1.1Thomas Woerner 8.13.4-1Thomas Woerner 8.13.3-2Jason Vas Dias 8.13.3-1.2Thomas Woerner 8.13.3-1.1Thomas Woerner 8.13.3-1Thox0"XVpkhI$xhIgIiIiří Klimeš - 1:1.0.6-8Jiří Klimeš - 1:1.0.6-7Beniamino Galvani - 1:1.0.6-6Thomas Haller - 1:1.0.6-5Thomas Haller - 1:1.0.6-4Lubomir Rintel - 1:1.0.6-3Lubomir Rintel - 1:1.0.6-2Lubomir Rintel - 1:1.0.6-1Jiří Klimeš - 1:1.0.4-10Thomas Haller - 1:1.0.4-9Beniamino Galvani - 1:1.0.4-8Lubomir Rintel - 1:1.0.4-7Jiří Klimeš - 1:1.0.4-6Thomas Haller - 1:1.0.4-5Lubomir Rintel - 1:1.0.4-4Lubomir Rintel - 1:1.0.4-3Jiří Klimeš - 1:1.0.4-2Lubomir Rintel - 1:1.0.4-1Jiří Klimeš - 1:1.0.4-0.2.git20150713.38bf2cb0Lubomir Rintel - 1:1.0.4-0.1.git20150713.38bf2cb0Thomas Haller - 1:1.0.3-2.git20150624.f245b49aLubomir Rintel - 1:1.0.3-1.git20150624.f245b49aLubomir Rintel - 1:1.0.3-1.git20150622.9c83d18dBeniamino Galvani - 1:1.0.0-17.git20150121.b4ea599cDan Williams - 1:1.0.0-16.git20150121.b4ea599cDan Williams - 1:1.0.0-15.git20150121.b4ea599cDan Winship - 1:1.0.0-14.git20150121.b4ea599cDan Williams - 1:1.0.0-13.git20150121.b4ea599cDan Winship - 1:1.0.0-12.git20150121.b4ea599cJiří Klimeš - 1:1.0.0-11.git20150121.b4ea599cDan Winship - 1:1.0.0-10.git20150121.b4ea599cDan Williams - 1:1.0.0-9.git20150121.b4ea599cJiří Klimeš - 1:1.0.0-8.git20150107.1ea95cd3Thomas Haller - 1:1.0.0-7.git20150107.1ea95cd3Lubomir Rintel - 1:1.0.0-6.git20150107.1ea95cd3Dan Williams - 1:1.0.0-5.git20150107.1ea95cd3Dan Winship - 1:1.0.0-4.git20150107.1ea95cd3Dan Winship - 1:1.0.0-3.git20150107.1ea95cd3Dan Williams - 1:1.0.0-2.git20150107.1ea95cd3Dan Williams - 1:1.0.0-1.git20150107.1ea95cd3Dan Williams - 1:0.995.0.0-1Dan Williams - 1:0.9.11.0-10.git20141211.9337a13aDan Williams - 1:0.9.11.0-9.git20141211.da4a98bfJiří Klimeš - 1:0.9.11.0-8.git20141125.f32075d2Jiří Klimeš - 1:0.9.11.0-7.git20141125.f32075d2Dan Williams - 1:0.9.11.0-6.git20141125.f32075d2Dan Williams - 1:0.9.11.0-5.git20141118.646f335dDan Williams - 1:0.9.11.0-4.git20141114.669f74b8Dan Williams - 1:0.9.11.0-3.git20141110.gitb75dfc62Dan Williams - 1:0.9.11.0-2.git20141107.git14537c71Dan Williams - 1:0.9.11.0-1.git20141107.git289f7881Florian Müllner - 1:0.9.9.1-47.git20140326Lubomir Rintel - 1:0.9.9.1-46.git20140326Lubomir Rintel - 1:0.9.9.1-45.git20140326Dan Winship - 1:0.9.9.1-44.git20140326Lubomir Rintel - 1:0.9.9.1-43.git20140326Jiří Klimeš - 1:0.9.9.1-42.git20140326Jiří Klimeš - 1:0.9.9.1-41.git20140326Jiří Klimeš - 1:0.9.9.1-40.git20140326Lubomir Rintel - 1:0.9.9.1-39.git20140326Dan Winship - 1:0.9.9.1-38.git20140326Lubomir Rintel - 1:0.9.9.1-37.git20140326Dan Winship - 1:0.9.9.1-36.git20140326Jiří Klimeš - 1:0.9.9.1-35.git20140326Dan Williams - 1:0.9.9.1-34.git20140326Jiří Klimeš - 1:0.9.9.1-33.git20140326Dan Williams - 1:0.9.9.1-32.git20140326Jiří KlimešxXW|0-p $`p q o 9a759de7e5708c302e9804e9e8314d7f27a95bde5062375d50c6c88610cf614f1e954810bb7ba5225f3cd2010d65106026c40daaf2fde362a00a69ab1dbd3c32d25aaeff7b0b16cbe5292756a54181358bb59abae15a3ad71c9d0888cb6e52e4939113abaf19e0a771213cb9ff7feb0a8518b41768dbf74da72dbe7661d77b8f84b7d61eba1786563ad3f27f845d7e5a9ad50e9c901334b7d36d19807e9201b18393371da628c592cb1f15168b5094b5204477cbecbbe8dbd9f5734d5a69ff850f65cf0c23af0ee5cecef9c2a445ab75a23d361adccd002a8d912296b14d7bf39d83e7d589759dfce831c5b0d2080af56386a37351acf0946b01f89ff8e9e8f3e1ab4976306567ee6a2ce483adba61c82c681b230da6ef0ee346544fc02f733731a745831cdbd885ad24a407560e5199d2b7cfa6df77dcd26bf4c720a9886a53ab8d7ec843150581ace98cfc5bbcf0e87a7ef7d2fda2b1a56bbc85f9576ee5ecfefc51c0e29a995b1d32667a9e1264336eb983a51e32e16546ff8d1765d9179f9d29ad03b5a9521529b02a460001f31fd62b78c30e4d1d6bab9d2c0770405bcc9ce2b6d63dfcffb4f1ac9a67a90ab53a81025ee0b9f3174f39f0f761e21b687e89b3859558775d916236f82f73d4bfcbd1c956de3325339091730de1dc1c9c361d4bd0a3286aa45e75bcddb83c4ba97f2169fd6dfe49f558cbe8e7d55ab2f3d5063ac0c285fb3d918cb2ae1c0112837db6739b2f7d84d665142841bd5757ea2cee27bb63b316cbe41924fa40649cd820b6fff895166b2d862db01b293178c0116cec4c3799266dd048af305e318c4bb8b7f31ba972549d0a54d1cd4e19782d90f128e3211b8d2a9458cf1a8654e53dce81cdbbd90d725c639c9eae0e14fdcb7c3dc54fa8cf34d13f424903079163f3cbb9c89a0ae8b436e34ac833df878992c8c6018398bfec35e7837a7a6fecbcfbd9614dbf2bee2b95453ec5e62f5279e18f0158b3ab2701fa53c4ee848365fe7d99940a7d1c1035547ccddd6c1ece79659511d1d0c0243d2321c6c61a51faa6eff1fdb2c1f36f0c3b48b9def39c370e0b6200d2c7835be373caee475d5819a4cd127059d1e09104590d19eebdaebe236a81451f67eb99976acdbbba788d2b80a400ffca264c111ddf0a8b794622dda12ac3ccf3cc8d8f7b1c5ca7f196f5382e3c6c51cbcc86be1b0ed302ca7f7ff3f09dc4af0d21032337819563a54d80950c84395109a1aba7c57f80b358970466a569d213c81044535bb040e6a463f896061f857b1971f9dbce08c294d38ef874da7fa61fe9a02599e0d9cd6a61966d5356e0c8048a5fb86194e93e3da363b9105f353830983c90dbdd220ea8d6d4f735f38baae58786f3e39e5e6723ece86b6283422442be6ad7163d1f0a87b8bb0a8cc390c6eccc45d6ddba33b1f0d95020f4472fd95cebea87b739039cac81e8b7e0e5343e73a351f7ee7bfb40bf11ebfb585e0f915d333ff4d81f7595d9701f8eae71b4fe5123818bb55740a0eecd90be4772d2b929ce3dd4c90a611396c46bd8b42eb185f8c7add1f31f090c8b5480a462a62202a793eedd427de2596ee6a86ed1073ab44dbb7537ac442b8b1481205780c259a8fa7cdb0290e881dabd488b449513c6da546343167d97f834cd02ee2714b407fdda2289bebd260fa993a55f3fc1c60f614351600a1abb598e8d864a844f3bd5958ff4822a0322ae3bafc540307aeb250fef37928c472245e42595cc00980daa6292e5616164cce61829aebb216a6629d827d355239eb742c5ae4frootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrox XU <$<<</bin/basename/bin/cat/bin/chgrp/bin/chmod/bin/chown/bin/cp/bin/cut/bin/date/bin/dd/bin/df/bin/echo/bin/env/bin/false/bin/ln/bin/ls/bin/mkdir/bin/mknod/bin/mktemp/bin/mv/bin/nice/bin/pwd/bin/readlink/bin/rm/bin/rmdir/bin/sleep/bin/sort/bin/stty/bin/sync/bin/touch/bin/true/bin/unamebundled(gnulib)config(coreutils)coreutilscoreutils(x86-64)fileutilslibstdbuf.so()(64bit)mktempsh-utilsstattextutils @@@@@@@@@@@@@@@@@@@@@@@@    @ /bin/sh/bin/sh/bin/sh/sbin/install-info/sbin/install-info/sbin/install-infoconfig(coreutils)gmpgreplibacl.so.1()(64bit)libacl.so.1(ACL_1.0)(64bit)libattr.so.1()(64bit)libattr.so.1(ATTR_1.1)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.15)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.6)(64bit)libc.so.6(GLIBC_2.7)(64bit)libcap.so.2()(64bit)libcrypto.so.10()(64bit)libcrypto.so.10(libcrypto.so.10)(64bit)libgmp.so.10()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.3.3)(64bit)libselinux.so.1()(64bit)ncursesrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PartialHardlinkSets)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)8.22-24.el7_9.23.0.4-14.6.0-14.0.4-14.0-15.2-1filesystem34.11.3_^\[#@Zhu@Z%8Z@YéWv[@VUUUUmS@RUR@RRʚRʚRƦ@RƦ@RTRkRH2@H1kH$H H@HHG@G G/@G@G:G@G]@Gt@GG9G@Gs@G8GG@G@G@GG@GGVGNGFG9G+@G'G%@G%@G @FvFvF@FFo@F@FEL@E@E݅EEّ@E՜EEѨ@E@EEEI@EfEe@ETiE4E#@E@E@DDC@D@DD@D5D@DDDzDzDbDDqDm@DiDhm@Dhm@DO`DGwD#@C@CC@C @CCC@CqC7@C@CyCx|@Cp@CbCbC\C=(C!y@C 'CB;BRB@BiBQBhB@B@B@BVr@BIC@BBB8B @B@BcAbAJA@A'@AIA@A_A|As@AbAa;@Aa;@Aa;@AT @AT @AF@A%A A @AAA~@@@@وxXV(\$L\]x6M!st QqAʶ"*cL>[v̳_Qn59IWE{*h}%4guIO཯MZGou@(&tVVC>Lc$VHb_Jͯ{v{xU%jͨ3[nSGzl[ a=}x?!:/6CRpruч͕ͣ$z;/HuY!p+ЖDw~mrA؈(JE&zD̵Ȕ4X*ʖwhj.NZP[L&wa83 WWME2%p];V𒘿48[ ߍv}a$ƨTS8Uɱ¾Is ޒE[*dڀuHHT]i9gx fe΢=k SZG;Za{y7arCnu.ǝK9F*pB/D%bZt`ظkΙ-o%rv`m)T:y'.?s`}ԀWDsプdGad\6x #Sji [(\m!yEtpq!e ,i1(]_||(0{hF%ϸYљ'>a YOw^<$x|S ’Qf6 %/% nv3qyG@Mɀ^u4SS uDX)9T@yN\"{ &v*H]QIM۪>"p9`FvzN';՝7+ MmKN?zfVVM;͖9wth45fbe17b0536dc08714157e8bf97b01a7f3f654eb"b (Jes Sorensen) [1380016] - [md] changes for MD_STILL_CLOSED flag (Jes Sorensen) [1380016] - [md] raid5: fix a small race condition (Jes Sorensen) [1380016] - [md] raid5: guarantee enough stripes to avoid reshape hang (Jes Sorensen) [1380016] - [md] raid5-cache: fix a deadlock in superblock write (Jes Sorensen) [1380016] - [md] raid5: avoid unnecessary bio data set (Jes Sorensen) [1380016] - [md] raid5: fix memory leak of bio integrity data (Jes Sorensen) [1380016] - [md] raid10: record correct address of bad block (Jes Sorensen) [1380016] - [md] r5cache: set MD_JOURNAL_CLEAN correctly (Jes Sorensen) [1380016] - [md] don't print the same repeated messages about delayed sync operation (Jes Sorensen) [1380016] - [md] do not count journal as spare in GET_ARRAY_INFO (Jes Sorensen) [1380016] - [md] Prevent IO hold during accessing to faulty raid5 array (Jes Sorensen) [1380016] - [md] hold mddev lock to change bitmap location (Jes Sorensen) [1380016] - [md] raid5: fix incorrectly counter of conf->empty_inactive_list_nr (Jes Sorensen) [1380016] - [md] fix null pointer deference (Jes Sorensen) [1380016] - [md] raid10: improve random reads performance (Jes Sorensen) [1380016] - [md] add missing sysfs_notify on array_state update (Jes Sorensen) [1380016] - [md] Fix kernel module refcount handling (Jes Sorensen) [1380016] - [md] documentation: fix wrong value in md.txt (Jes Sorensen) [1380016] - [md] reduce the number of synchronize_rcu() calls when multiple devices fail (Jes Sorensen) [1380016] - [md] be extra careful not to take a reference to a Faulty device (Jes Sorensen) [1380016] - [md] multipath: add rcu protection to rdev access in multipath_status (Jes Sorensen) [1380016] - [md] raid5: add rcu protection to rdev accesses in raid5_status (Jes Sorensen) [1380016] - [md] raid5: add rcu protection to rdev accesses in want_replace (Jes Sorensen) [1380016] - [md] raid5: add rcu protection to rdev accesses in handle_failed_sync (Jes Sorensen) [1380016] - [md] raid1: add rcu protection to rdev in fix_read_error (Jes Sorensen) [1380016] - [md] raid1: small code cleanup in end_sync_write (Jes Sorensen) [1380016] - [md] raid1: small cleanup in raid1_end_read/write_request (Jes Sorensen) [1380016] - [md] raid10: simplify print_conf a little (Jes Sorensen) [1380016] - [md] raid10: minor code improvement in fix_read_error() (Jes Sorensen) [1380016] - [md] raid10: add rcu protection to rdev access during reshape (Jes Sorensen) [1380016] - [md] raid10: add rcu protection to rdev access in raid10_sync_request (Jes Sorensen) [1380016] - [md] raid10: add rcu protection in raid10_status (Jes Sorensen) [1380016] - [md] raid10: fix refounct imbalance when resyncing an array with a replacement device (Jes Sorensen) [1380016] - [md] raid1, raid10: don't recheck "Faulty" flag in read-balance (Jes Sorensen) [1380016] - [md] disconnect device from personality before trying to remove it (Jes Sorensen) [1380016] - [md] MD:Update superblock when err == 0 in size_store (Jes Sorensen) [1380016] - [md] use a mutex to protect a global list (Jes SxX=W8{mu$}muluD5 ]!7:y݂ 1IqEzl&ˡ:MT@Tr_j Ґv|!:J͸~95`ZA x:DoMZ}Wiۦ)êE]=M5׽57nV!*e]KSmEG@[]eb-daC!i6Q!ŏF{9Xb(gE fQtijfౝJɉ^`$ƨɟ*7h?=3@ޝ8/L߸,1n)Ȫ>8wtZ@4ᾣd'1!ԭcgUTIKg,V*tyR%˳vZ? ό z3Z ]2]>kt$Qq0.4_#΅5JRhX๹7@8މVP 8w4 L;l ,{Q'i[L甉u-rTSOUJ2#@%U[_ʏu;Xj?xcJr8hI>B3#5=y򖣲հ؅l\Jnt{0D N X l q xk()*+,-89D: @BDGHI(X0YPZ[\]^*bdefltuvwxy 48H_ _ 04<g@hDCphp81-php-pecl-mcrypt1.0.71.el7.remiBindings for the libmcrypt libraryProvides bindings for the unmaintained libmcrypt. Package built for PHP 8.1 as Software Collection (php81 by remi).ebuilder.remirepo.netRemi's RPM repository #StandWithUkrainePHP-3.01Remi ColletUnspecifiedhttps://pecl.php.net/package/mcryptlinuxx86_64if [ $1 -eq 0 -a -x /opt/remi/php81/root/usr/bin/pecl ] ; then /opt/remi/php81/root/usr/bin/pecl uninstall --nodeps --ignore-errors --register-only mcrypt >/dev/null || : fi2< 0A큤eeeeved9851e631d7f8c21adca690743865ac4f92154dd2464707a3d786904bb8c0d895bda7d392ae62a81f83ff2dbc44c217fafa1988a101b39c2db53c106feb3c013894f84de489dc5123692df0354857c0b326a3931982f78ac816457b0a6219903c3c41df69f09cba1508330f10ea9d030e91b013f708a515ddd9eeae80f0d1dc3rootrootrootrootrootrootrootrootrootrootphp81-php-pecl-mcrypt-1.0.7-1.el7.remi.src.rpmconfig(php81-php-pecl-mcrypt)php81-php-mcryptphp81-php-mcrypt(x86-64)php81-php-pecl(mcrypt)php81-php-pecl(mcrypt)(x86-64)php81-php-pecl-mcryptphp81-php-pecl-mcrypt(x86-64)scl-package(php81) @@@@@@   @ /bin/sh/bin/sh/bin/shconfig(php81-php-pecl-mcrypt)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)libmcrypt.so.4()(64bit)php81-php(api)php81-php(zend-abi)php81-runtimerpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)1.0.7-1.el7.remi20210902-6420210902-643.0.4-14.6.0-14.0-15.2-14.11.3if [ -x /opt/remi/php81/root/usr/bin/pecl ] ; then /opt/remi/php81/root/usr/bin/pecl install --nodeps --soft --force --register-only --nobuild /var/opt/remi/php81/lib/pear/pkgxml/php81-php-pecl-mcrypt.xml >/dev/null || : fi # posttrans as pear can be installed after usphp81-php-peared@c>@bw@a/k@`@`@_ǁ_@]@]nU]6\]o@\8@[ug@[O+[ @ZV@Ym@Y_wYJ_XRemi Collet - 1.0.7-1Remi Collet - 1.0.6-2Remi Collet - 1.0.6-1Remi Collet - 1.0.5-1Remi Collet - 1.0.4-5Remi Collet - 1.0.4-4Remi Collet - 1.0.4-3Remi Collet - 1.0.4-1Remi Collet - 1.0.3-4Remi Collet - 1.0.3-1Remi Collet - 1.0.2-4Remi Collet - 1.0.2-3Remi Collet - 1.0.2-2Remi Collet - 1.0.2-1Remi Collet - 1.0.1-8Remi Collet - 1.xXVj$Ojjj0, middle-end/57103, rtl-optimization/56605, rtl-optimization/56847, rtl-optimization/57003, rtl-optimization/57130, rtl-optimization/57131, rtl-optimizations/57046, sanitizer/56990, target/44578, target/55445, target/56797, target/56866, target/57018, target/57091, target/57097, target/57098, target/57106, target/57108, target/57150, tree-optimization/57051, tree-optimization/57066, tree-optimization/57083, tree-optimization/57104, tree-optimization/57149, tree-optimization/57185 - fix gcj with -fsection-anchors (#952673, PR libgcj/57074) - enable libitm on s390{,x} - error when linking with both -fsanitize=address and -fsanitize=thread (#957778)- update from the 4.8 branch - PRs c++/56388, fortran/56816, fortran/56994, rtl-optimization/56992, target/56890, target/56903, target/56948, tree-optimization/56962, tree-optimization/56984 - fix up LRA caused miscompilation of xulrunner on i?86 (#949553, PR rtl-optimization/56999) - reassoc fix for -Ofast -frounding-math (PR tree-optimization/57000)- update from the 4.8 branch - PRs c++/35722, c++/45282, c++/52014, c++/52374, c++/52748, c++/54277, c++/54359, c++/54764, c++/55532, c++/55951, c++/55972, c++/56039, c++/56447, c++/56582, c++/56646, c++/56692, c++/56699, c++/56722, c++/56728, c++/56749, c++/56772, c++/56774, c++/56793, c++/56794, c++/56821, c++/56895, c++/56913, debug/56819, fortran/54932, fortran/56696, fortran/56735, fortran/56737, fortran/56782, libstdc++/55977, libstdc++/55979, libstdc++/56002, libstdc++/56678, libstdc++/56834, lto/56777, middle-end/56694, middle-end/56768, middle-end/56883, other/55274, rtl-optimization/48182, rtl-optimization/56745, sanitizer/55702, target/54805, target/55487, target/56560, target/56720, target/56771, tree-optimization/48184, tree-optimization/48186, tree-optimization/48762, tree-optimization/56407, tree-optimization/56501, tree-optimization/56817, tree-optimization/56837, tree-optimization/56899, tree-optimization/56918, tree-optimization/56920- update from the 4.8 branch - GCC 4.8.0 release - PRs c++/56607, other/43620 - fix length in .debug_aranges in some cases - improve debug info for optimized away global vars (PR debug/56608) - don't warn about signed 1-bit enum bitfields containing values 0 and -1 or just -1 (PR c/56566)- update from the 4.8 branch - PRs libstdc++/56468, target/56640, tree-optimization/56635, tree-optimization/56661 - package libasan_preinit.o- update from trunk and the 4.8 branch - PRs ada/52123, c++/51412, c++/51494, c++/51884, c++/52183, c++/56222, c++/56346, c++/56565, c++/56567, c++/56611, c++/56614, debug/56307, fortran/56575, fortran/56615, libstdc++/56492, libstdc++/56609, libstdc++/56613, lto/56557, middle-end/56524, middle-end/56571, target/40797, target/49880, target/56470, target/56591, target/56619, testsuite/54119, tree-optimization/53265, tree-optimization/56478, tree-optimization/56570, tree-optimization/56608- updated from trunk - PRs bootstrap/56509, c++/54383, c++/55135, c++/56464, c++/56530, c++/56534, c++/56543, debug/55364, debug/56510, libquadmath/55473, lto/50293, lto/56515, middle-end/50494, middle-end/56294, middle-end/56525, middle-end/56526, middle-end/56548, rtl-optimization/56484, rtl-optimization/56494, target/56529, tree-optimization/56270, tree-optimization/56521, tree-optimization/56539, tree-optimization/56559 - include arm-cores.def in gcc-python-plugin on arm (#910926) - include vxworks-dummy.h in gcc-python-plugin where needed (PR plugins/45078)- updated from trunk - PRs c++/10291, c++/40405, c++/52688, c++/55632, c++/55813, c++/56243, c++/56358, c++/56359, c++/56377, c++/56395, c++/56403, c++/56419, c++/56438, c++/56481, fortran/54730, fortran/56385, fortran/56416, fortran/56477, fortran/56491, libfortran/30162, libstdc++/56011, libstdc++/56012, middle-end/45472, middle-end/56077, middle-end/56108, middle-end/56420, middle-end/56461, rtl-optimization/50339, rtl-optimization/56466, sanitizer/56393, sanitizer/56454, target/48901, target/52500, target/52501, taxhXU(<$:<<<oconf patches.- Prevent 'su --help' showing runuser-only options such as --group.- Unbreak id (bug #217177).- Fixed stat's 'C' format specifier (bug #216676). - Misleading 'id -Z root' error message (bug #211089).- Clarified runcon man page (bug #213846).- Own LC_TIME locale directories (bug #210751).- Fixed 'cp -Z' when destination exists, again (bug #189967).- Back-ported rename patch (bug #205744).- Ignore 'cifs' filesystems for 'df -l' (bug #183703). - Include -g/-G in runuser man page (part of bug #199344). - Corrected runuser man page (bug #200620).- Fixed warnings in pam, i18n, sysinfo, selinux and acl patches (bug #203166).- Don't chdir until after PAM bits in su (bug #197659).- Fixed 'sort -b' multibyte problem (bug #199986).- Added runuser '-g' and '-G' options (bug #199344). - Added su '--session-command' option (bug #199066).- 'include' su and runuser scripts in su-l and runuser-l scripts- split the PAM scripts for "su -l"/"runuser -l" from that of normal "su" and "runuser" (#198639) - add keyinit instructions to PAM scripts- rebuild- allow root to su to expired user (#152420)- Allow 'sort +1 -2' (patch from upstream).- 5.97. No longer need tempname or tee patches, or pl translation.- Include new hashes (bug #196369). Patch from upstream. - Build at -O1 on s390 for the moment (bug #196369).- Fix large file support for temporary files.- Fixed Polish translation.- 5.96. No longer need proc patch.- Fixed pr properly in multibyte locales (bug #192381).- Upstream patch to fix cp -p when proc is not mounted (bug #190601). - BuildRequires libacl-devel.- Fixed pr in multibyte locales (bug #189663).- 5.95.- Avoid redeclared 'tee' function. - Fix 'cp -Z' when the destination exists (bug #189967).- Make 'ls -Z' output more consistent with other output formats.- 5.94.- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- Fixed chcon(1) bug reporting address (bug #178523).- Don't suppress chown/chgrp errors in install(1) (bug #176708).- Remove pam_selinux.so from su.pamd, not needed for targeted and Strict/MLS will have to newrole before using.- Fix "sort -n" (bug #176468).- Explicitly set default POSIX2 version during configure stage.- rebuilt- Parametrize SELinux (bug #174067). - Fix runuser.pamd (bug #173807).- Rebuild to pick up new glibc *at functions. - Apply runuser PAM patch from bug #173807. Ship runuser PAM file.- Remove multiple from su.pamd- Call setsid() in su under some circumstances (bug #173008). - Prevent runuser operating when setuid (bug #173113).- 5.93. - No longer need alt-md5sum-binary, dircolors, mkdir, mkdir2 or tac patches.- Finished porting i18n patch to sort.c. - Fixed for sort-mb-tests (avoid +n syntax).- Fix chgrp basic test. - Include md5sum patch from ALT.- 5.92. - No longer need afs, dircolors, utmp, gcc4, brokentest, dateseconds, chown, rmaccess, copy, stale-utmp, no-sign-extend, fchown patches. - Updated acl, dateman, pam, langinfo, i18n, getgrouplist, selinux patches. - Dropped printf-ll, allow_old_options, jday, zh_CN patches. - NOTE: i18n patch not ported for sort(1) yet.- use include instead of pam_stack in pam config- Reverse change to use raw functions- Explicit setuid bit for /bin/su in file manifest (bug #167745).- Allow id to run even when SELinux security context can not be run - Change chcon to use raw functions.- Corrected comments in DIR_COLORS.xterm (bug #161711).- Fixed stale-utmp patch so that 'who -r' and 'who -b' work again (bug #161264).- Use upstream hostid fix.- Don't display the sign-extended part of the host id (bug #160078).- Eliminate bogus "can not preserve context" message when moving files.- Prevent buffer overflow in who(1) (bug #158405).- Better error checking in the pam patch (bug #158189).- Fix SELinux patch to better handle MLS integration- Applied Russell Coker's selinux changes (bug #157856).- Fixed pam patch from Steve Grubb (bug #154946). - Use better upstream patch for "stale utmp".- Added "stale utmp" patch from xXUa$:aab12c6830755821cbf00f76d9dcc5c8623d7d500954391c032ec6cc9e0971179e512c6830755821cbf0092ca7ecefb3efc0f743fd44d1d2f12dbb7f593c7f8f331b605e9768f0655e72de67d4ef2a935807857dd6a3815d752a52798f682bc49cfe6e31394fc727e8c9ae67d4ef2a935807857dd6a3815d752a52798f682bc49cfe6e31394fc727e8c9a0bf021d14ae7c9fd97284e6efa83fa9968b5e91ccc49780c035ba1052030298f68066cfaf418631076e9238c0d29cd5af36e98b8400c71b089386deb31621c3768066cfaf418631076e9238c0d29cd5af36e98b8400c71b089386deb31621c374522450c638fd802784f466c709da1c85f6cb0e5a9f6dfd2fc3b673a64fe599f507470a4a0789e1b90a6dc1cb0b1de4b0331055288c6ab38ec86d42c97108896507470a4a0789e1b90a6dc1cb0b1de4b0331055288c6ab38ec86d42c971088964d76ab7e5849471a9ea5a44d483c3a2455151b3e4fd53d42e3fb85f5546a8f7c69bc7491e2c95ce666c52b5954389028aada4c09f526a0b2112c601029fb2da669bc7491e2c95ce666c52b5954389028aada4c09f526a0b2112c601029fb2da6589b78b7cde42e6aff527a42585b8ba326b366bdf001438497a0039f7a2ca0409bf2860e5e45b87b37c6ef2255658ac481c83103df50a9ed954f5f4cc94163b49bf2860e5e45b87b37c6ef2255658ac481c83103df50a9ed954f5f4cc94163b40d1ccdf1a040943054a350762831f3769452cd705f1f8ace3b3d22b875db41c8de86be894fcad7b196a199703bdf2e1143acea8c990ea4dd017c6643d7892182de86be894fcad7b196a199703bdf2e1143acea8c990ea4dd017c6643d7892182e8c86e561642255e177cfa4f49458a9432cb1848b4636665190f536ec98914bde6f80519881cd9c0bef0a768a4c11eec5f1920f300adcdcf97ade95e11f47a21e6f80519881cd9c0bef0a768a4c11eec5f1920f300adcdcf97ade95e11f47a2168d78e7db5921a670debd5261067f8b49f902312d3e92539ca7ce6d625a07a90c000c505790264635cdc2b647400d2d2eea2380291fcbbfb774e055c91190edec000c505790264635cdc2b647400d2d2eea2380291fcbbfb774e055c91190edead1ac9a438dc3f682340dba4102bb8174dba3fe0a45bedc26b6b4de8e89af85c56ff53e78ce8caf16f128bede5aa32e39ade2d72ac2b58987e308bd68356a78356ff53e78ce8caf16f128bede5aa32e39ade2d72ac2b58987e308bd68356a783c81f45f9f0d0a73bb5bfc701a0a808acbd9271436a8e592a133b58ac654243ed57739dc0f892a890ecdf091669dfa2d1d5b9e5cf65e787dd3f8814e1e48bca4957739dc0f892a890ecdf091669dfa2d1d5b9e5cf65e787dd3f8814e1e48bca4981facaceffba5b93a3ccd21f8ef25a424c400512f29b62b08df2855d274307adf5b6db32d8b4650d75f039eabdc7c5e31914a8cfd7be91f08bf05382b22915cbf5b6db32d8b4650d75f039eabdc7c5e31914a8cfd7be91f08bf05382b22915cbc4b2d4308201e4cade09d633459e732115ab853442a0c3bc459107e163c540360c03d3f7f7875534c8d84754ce8ceecb254d53f7dfd710fd16c318d96fc115380c03d3f7f7875534c8d84754ce8ceecb254d53f7dfd710fd16c318d96fc11538b6d233abad0fc23472acb41419d02d7d8bece1fce2570bdc2ded8ac3e86f13483a6b5a5773bb7d7a8c4acaeb27acf2208bc297c10b969f04c3adf2f8f327f68c3a6b5a5773bb7d7a8c4acaeb27acf2208bc297c10b969f04c3adf2f8f327f68c64464c2f41696c1fbe18878114fbd2cdbb65549e84b11e2d088e2a07b0fcb054ea19d462abd3577511956c1f7bf0e1d068111bbb138caa0e6f8be6956c0754e0ea19d462abd3577511956c1f7bf0e1d068111bbb138caa0e6f8be6956c0754e08f6e29e9d30dcd4a4666d4f7050c7046813e17cf225a60692a0bb4b5157ad4549771a08b34e084a97fe6a9de09ab35d2708a9f94b3c9139025803297979022259771a08b34e084a97fe6a9de09ab35d2708a9f94b3c913902580329797902225db33401b9f5023bbc59428fb92a0e1d09ac0613a5ec4e9c8e793c40088d886aa9e084c0fd339833c9d72fbe9e26e02f11ed1b0c332dc3ce77d3a07c0db9a56559e084c0fd339833c9d72fbe9e26e02f11ed1b0c332dc3ce77d3a07c0db9a5655e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b8551dc7ee18d6dd875c8733c03d56a456eeb7f25bfa3f2e2dd763fb44f593c6add61dc7ee18d6dd875c8733c03d56a456eeb7f25bfa3f2e2dd763fb44f593c6add6d8f7e72f921b295c1d28fec2f01d4e52f884b6e04e6f0a07e2900f7ef1c8bd07415195fa5db12be230d33910e2c86f37d1e9d9c1d780c50545b60877f9b4f9f2415195fa5db12be230d33910e2c86f37d1e9d9c1d780c50545b60877f9b4f9f21120d77695204cac9e1660834a7266069f3338d8c9925b1124ebf2e0eb5a00b732fe4da48e8967087f90a208867c42dee383a78ae094b6f6f4fc1289fec70b3832fe4da48e8967087f90a208867c42dee383a78ae094b6f6f4fc1289fec70b38ee96b3f48b03e6abffb6f93946b7b762b940dbfd9a4b51497c8ed496bcc0b566b5d442119d94d3302c6bc30d3915be06f14f07718ef5c0871e092869fc72662d819413f491005d76c0d9ffcc95d6b6eea4c401167e77b7e0a3b41f6b9f1b81b6e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b85530e75eca423be5ba0xXXWb@$flds- update to 5.4.9- fix php.conf- filter private shared in _httpd_modir - improve system libzip patch to use pkg-config - use _httpd_contentdir macro and fix php.gif path - switch back to upstream generated scanner/parser - use system pcre only when recent enough- improves php.conf, no need to be relocated- clarify Licenses - missing provides xmlreader and xmlwriter - change php embedded library soname version to 5.4- fix mysql_sock macro definition- fix standard build (non scl)- fix installed headers- use libldap_r for ldap extension- add missing scl_prefix in some provides/requires- make php-enchant optionnal, not available on RHEL-5 - make php-recode optionnal, not available on RHEL-5 - disable t1lib on RHEL-5- enable tidy on RHEL-6 only - re-enable unit tests- minor macro fixes for RHEL-5 build - update autotools workaround for RHEL-5 - use readline when libedit not available (RHEL-5)- update to 5.4.8 - define both session.save_handler and session.save_path - fix possible segfault in libxml (#828526) - use SKIP_ONLINE_TEST during make test - php-devel requires pcre-devel and php-cli (instead of php) - provides php-phar - update systzdata patch to v10, timezone are case insensitive- php-fpm: create apache user if needed - php-cli: provides cli command in standard root (scl)- add configtest option to init script - test configuration before service reload - fix php-fpm service relocation - fix php-fpm config relocation - drop embdded subpackage for scl- missing requires on scl-runtime - relocate /var/lib/session - fix php-devel requires - rename, but don't relocate macros.php- initial spec rewrite for scl build- fix typo in systemd macro- php-fpm: enable PrivateTmp - php-fpm: new systemd macros (#850268) - php-fpm: add upstream patch for startup issue (#846858)- systemd integration, https://bugs.php.net/63085 - no odbc call during timeout, https://bugs.php.net/63171 - check sqlite3_column_table_name, https://bugs.php.net/63149- most failed tests explained (i386, x86_64)- fix for http://bugs.php.net/63126 (#783967)- patch to ensure we use latest libdb (not libdb4)- really fix rhel tests (use libzip and libdb)- fix test to enable zip extension on RHEL-7- remove session.save_path from php.ini move it to apache and php-fpm configuration files- update to 5.4.7 http://www.php.net/releases/5_4_7.php - php-fpm: don't daemonize- enable php-fpm on secondary arch (#849490)- update to 5.4.6 - update to v9 of systzdata patch - backport fix for new libxml- update to 5.4.5- also provide php(language)%{_isa} - define %{php_version}- drop BR for libevent (#835671) - provide php(language) to allow version check- add missing provides (core, ereg, filter, standard)- update to 5.4.4 (CVE-2012-2143, CVE-2012-2386) - use /usr/lib/tmpfiles.d instead of /etc/tmpfiles.d - use /run/php-fpm instead of /var/run/php-fpm- update to 5.4.3 (CVE-2012-2311, CVE-2012-2329)- update to 5.4.2 (CVE-2012-1823)- update to 5.4.1- rebuild for new icu - switch (conditionally) to libdb-devel- fix Loadmodule with MPM event (use ZTS if not MPM worker) - split conf.d/php.conf + conf.modules.d/10-php.conf with httpd 2.4- rebuild for missing automatic provides (#807889)- really use _httpd_mmn- rebuild against httpd 2.4 - use _httpd_mmn, _httpd_apxs macros- update to PHP 5.4.0 finale- update to PHP 5.4.0RC8- update to PHP 5.4.0RC7 - provides env file for php-fpm (#784770) - add patch to use system libzip (thanks to spot) - don't provide INSTALL file- all binaries in /usr/bin with zts prefix- update to PHP 5.4.0RC6 https://fedoraproject.org/wiki/Features/Php54- fix systemd unit- switch to systemd- Rebuild for new libpng- rebuild with new gmp without compat lib- rebuild with new gmp- revert is_a() to php <= 5.3.6 behavior (from upstream) with new option (allow_string) for new behavior- add mysqlnd sub-package - drop patch4, use --libdir to use /usr/lib*/php/build - add patch to redirect mysql.sock (in mysqlnd)- update to 5.3.8 http://www.php.net/ChangeLog-5.php#5.3.8- update to 5x|XXXw`$ileinfo)- fix regression in str_{i,}replace (from upstream)- update to 5.2.1 - add Requires(pre) for httpd - trim %changelog to versions >= 5.0.0- bump default memory_limit to 32M (#220821) - mark config files noreplace again (#174251) - drop trailing dots from Summary fields - use standard BuildRoot - drop libtool15 patch (#226294)- add php(api), php(zend-abi) provides (#221302) - package /usr/share/php and append to default include_path (#225434)- fix filter.h installation path - fix php-zend-abi version (Remi Collet, #212804)- rebuild again- rebuild for net-snmp soname bump- build json and zip shared, in -common (Remi Collet, #215966) - obsolete php-json and php-pecl-zip - build readline extension into /usr/bin/php* (#210585) - change module subpackages to require php-common not php (#177821)- provide php-zend-abi (#212804) - add /etc/rpm/macros.php exporting interface versions - synch with upstream recommended php.ini- update to 5.2.0 (#213837) - php-xml provides php-domxml (#215656) - fix php-pdo-abi provide (#214281)- rebuild for curl soname bump - add build fix for curl 7.16 API- from upstream: add safety checks against integer overflow in _ecalloc- update to 5.1.6 (security fixes) - bump default memory_limit to 16M (#196802)- rebuild- Provide php-posix (#194583) - only provide php-pcntl from -cli subpackage - add missing defattr's (thanks to Matthias Saou)- move Obsoletes for php-openssl to -common (#194501) - Provide: php-cgi from -cli subpackage- split out php-cli, php-common subpackages (#177821) - add php-pdo-abi version export (#193202)- rebuilt for new libnetsnmp- provide mod_php (#187891) - provide php-cli (#192196) - use correct LDAP fix (#181518) - define _GNU_SOURCE in php_config.h and leave it defined - drop (circular) dependency on php-pear- update to 5.1.4- update to 5.1.3- provide php-api (#183227) - add provides for all builtin modules (Tim Jackson, #173804) - own %{_libdir}/php/pear for PEAR packages (per #176733) - add obsoletes to allow upgrade from FE4 PDO packages (#181863)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild for new libc-client soname- only build xmlreader and xmlwriter shared (#177810)- update to 5.1.2- rebuild again- rebuild for new net-snmp- enable short_open_tag in default php.ini again (#175381)- rebuilt- require net-snmp for php-snmp (#174800)- add /usr/share/pear back to hard-coded include_path (#174885)- rebuild for httpd 2.2- update to 5.1.1 - remove pear subpackage - enable pdo extensions (php-pdo subpackage) - remove non-standard conditional module builds - enable xmlreader extension- rebuilt against new openssl- pear: update to XML_RPC 1.4.4, XML_Parser 1.2.7, Mail 1.1.9 (#172528)- rebuild for new libnetsnmp- update to 5.0.5 - add fix for upstream #34435 - devel: require autoconf, automake (#159283) - pear: update to HTTP-1.3.6, Mail-1.1.8, Net_SMTP-1.2.7, XML_RPC-1.4.1 - fix imagettftext et al (upstream, #161001)- ldap: restore ldap_start_tls() function- disable RPATHs in shared extensions (#156974)- build simplexml_import_dom even with shared dom (#156434) - prevent truncation of copied files to ~2Mb (#155916) - install /usr/bin/php from CLI build alongside CGI - enable sysvmsg extension (#142988)- prevent build of builtin dba as well as shared extension- split out dba and bcmath extensions into subpackages - BuildRequire gcc-c++ to avoid AC_PROG_CXX{,CPP} failure (#155221) - pear: update to DB-1.7.6 - enable FastCGI support in /usr/bin/php-cgi (#149596)- build /usr/bin/php with the CLI SAPI, and add /usr/bin/php-cgi, built with the CGI SAPI (thanks to Edward Rudd, #137704) - add php(1) man page for CLI - fix more test cases to use -n when invoking php- rebuild for new libpq soname- bundle from PEAR: HTTP, Mail, XML_Parser, Net_Socket, Net_SMTP - snmp: disable MSHUTDOWN function to prevent error_log noise (#153988) - mysqli: add fix for crash on x86_64 (Georg Richter, upstream #32282)- build shared objects as PIC (#154195)- fix PEAR instaxHlXW $)dmail.cf - add milter patch- ignore DAEMON=no; that configuration no longer functions- make sure more version information is in the cf file #54418 - do not use "-b" flag when patching in spec file - require newer chkconfig version #61035 - fix preun script #60880 - add TMPF to access file creation #60956- mv include files to /usr/include/libmilter/ #60795 - do not use "-f" option to virtusertable #60196 - ad an example smarthost entry to config file #58298- use alternatives --initscript support - run chkconfig --add before alternatives- run alternatives --remove in %preun - add some prereqs- fix smmsp useradd invocation in %pre - switch back to db3 for storing db files- update to 8.12.2 (adds STARTTLS support without need for sfio) - don't forcibly strip binaries; let the build root handle it - add creation of the smmsp account (51/51) in %pre - enable hesiod map support - modify default config to use an MSP - comment out 'O AutoRebuildAliases' in %post, otherwise sendmail will fail to restart on upgrades- add proper ifdefs around new alternative stuff to also be able to build this for older releases- %triggerpostun on older versions to make sure alternatives work on upgrades- clean up alternatives somewhat, provide /usr/sbin/sendmail & friends- Use alternatives- fix quotation in spec-file- integrate ugly logic to compile this src.rpm also on older Red Hat Linux releases - clean up spec file and patches a bit - add db4 support- fix another path to correct docu - include sendmail/README in the docu - compile with -D_FFR_WORKAROUND_BROKEN_NAMESERVERS, but do not enable this at runtime - devel subpackage files owned by root now- change "-q" to "-s" as option to make #57216 - move milter lib into separate "devel" sub-package - add include files to devel sub-package #56064 - fix pointer in access file to docu #54351- add libmilter docu - add support for userdb to /etc/mail/Makefile - use "btree" database files if a userdb is used - buildrequires tcp_wrappers- fix libmilter support - fix init script to use /etc/mail/Makefile #52932- add libmilter library- update to 8.11.6 - correctly use /etc/mail/statistics- change init script back to older conventions #51297 - remove DoS patch, not needed anymore #51247- add option '-t' to procmail for local mail delivery- point to the map files in sendmail.cf as pointed out by David Beveridge - add build requires #49695 - do not call "userdel"- change sendmail.cf to "noreplace"- update to 8.11.4- update to 8.11.3 - add "localhost.localdomain" to the list of hostnames accepted for local delivery "Cw" in /etc/mail/sendmail.mc - add patches from Pekka Savola - Enable IPv6 at compile time, patch for glibc 2.2 from PLD - Add a commented-out IPv6 daemon .mc line to sendmail.mc - buildrequire: openldap-devel, cyrus-sasl-devel- rebuild in new environment- add noreplace for /etc/sysconfig/sendmail and /etc/mail/sendmail.mc- add changes from Christopher McCrory : - prepare /etc/mail/Makefile for more maps not shipped with this rpm - changed sendmail.mc to include some more commented out options, so that people are directly pointed at important options - add /etc/pam.d/smtp for AUTH - add FEATURE(use_ct_file) and /etc/mail/trusted-users- don't obsolete postfix and exim, only conflict (for RHN purposes)- obsolete and conflict with exim and postfix- fix devision by zero bug in #20395 - mv /usr/lib/sendmail-cf /usr/share/sendmail-cf- i18n tweaks to initscript- aliases.db should be owned by group root- prepare for startup-script translation- enable daemon mode again, but only listen to the loopback device instead of all devices. - do not include check.tar with old anti-spam rules- fix configuration of /etc/aliases- fix interoperation problems with communigate pro - disable msa- update to (security release) 8.11.2 - build also on RHL 6.x #16061 - include smrsh man-page #17901 - use the "-f" flag for makemap to preserve case for virtusertable and usx[XW$c- Fix filter bypass in filter_var FILTER_VALIDATE_URL CVE-2024-5458- use oracle client library version 21.13 - Fix __Host-/__Secure- cookie bypass due to partial CVE-2022-31629 fix CVE-2024-2756 - Fix password_verify can erroneously return true opening ATO risk CVE-2024-3096- Fix Security issue with external entity loading in XML without enabling it GHSA-3qrf-m4j2-pcrr CVE-2023-3823 - Fix Buffer mismanagement in phar_dir_read() GHSA-jqcx-ccgc-xwhv CVE-2023-3824- fix possible buffer overflow in date- Fix Missing error check and insufficient random bytes in HTTP Digest authentication for SOAP GHSA-76gg-c692-v2mw CVE-2023-3247 - use oracle client library version 21.10 - define __phpize and __phpconfig- fix #81744: Password_verify() always return true with some hash CVE-2023-0567 - fix #81746: 1-byte array overrun in common path resolve code CVE-2023-0568 - fix DOS vulnerability when parsing multipart request body CVE-2023-0662- pdo: fix #81740: PDO::quote() may return unquoted string CVE-2022-31631 - use oracle client library version 21.8- phar: fix #81726 DOS when using quine gzip file. CVE-2022-31628 - core: fix #81727 Don't mangle HTTP variable names that clash with ones that have a specific semantic meaning. CVE-2022-31629 - use oracle client library version 21.7- use oracle client library version 21.6 - mysqlnd: fix #81719: mysqlnd/pdo password buffer overflow. CVE-2022-31626 - pgsql: fix #81720: Uninitialized array in pg_query_params(). CVE-2022-31625- Fix #79971 special character is breaking the path in xml function CVE-2021-21707- fix PHP-FPM oob R/W in root process leading to priv escalation CVE-2021-21703 - use libicu version 69 - use oracle client library version 21.3- Fix #81211 Symlinks are followed when creating PHAR archive- Fix #81122 SSRF bypass in FILTER_VALIDATE_URL CVE-2021-21705 - Fix #76488 Memory leak when fetching a BLOB field - Fix #76448 Stack buffer overflow in firebird_info_cb - Fix #76449 SIGSEGV in firebird_handle_doer - Fix #76450 SIGSEGV in firebird_stmt_execute - Fix #76452 Crash while parsing blob data in firebird_fetch_blob CVE-2021-21704- Fix #80710 imap_mail_compose() header injection - use oracle client library version 21.1- Fix #80672 Null Dereference in SoapClient CVE-2021-21702 - better fix for #77423- Fix #77423 FILTER_VALIDATE_URL accepts URLs with invalid userinfo CVE-2020-7071- Core: Fix #79699 PHP parses encoded cookie names so malicious `__Host-` cookies can be sent CVE-2020-7070- Core: Fix #79877 getimagesize function silently truncates after a null byte - Phar: Fix #79797 use of freed hash key in the phar_parse_zipfile function CVE-2020-7068- Core: Fix #78875 Long filenames cause OOM and temp files are not cleaned CVE-2019-11048 Fix #78876 Long variables in multipart/form-data cause OOM and temp files are not cleaned- standard: Fix #79330 shell_exec silently truncates after a null byte Fix #79465 OOB Read in urldecode CVE-2020-7067- standard: Fix #79329 get_headers() silently truncates after a null byte CVE-2020-7066 - exif: Fix #79282 Use-of-uninitialized-value in exif CVE-2020-7064 - use oracle client library version 19.6 (18.5 on EL-6)- dom: Fix #77569 Write Access Violation in DomImplementation - phar: Fix #79082 Files added to tar with Phar::buildFromIterator have all-access permissions CVE-2020-7063 - session: Fix #79221 Null Pointer Dereference in PHP Session Upload Progress CVE-2020-7062- mbstring: Fix #79037 global buffer-overflow in mbfl_filt_conv_big5_wchar CVE-2020-7060 - standard: Fix #79099 OOB read in php_strip_tags_ex CVE-2020-7059- bcmath: Fix #78878 Buffer underflow in bc_shift_addsub CVE-2019-11046 - core: Fix #78862 link() silently truncates after a null byte on Windows CVE-2019-11044 Fix #78863 DirectoryIterator class silently truncates after a null byte CVE-2019-11045 - exif Fix #78793 Use-after-free in exif parsing under memory sanitizer CVE-2019-11050 Fix #78910 Heap-buffer-overflow READ in exif CVEx8KX_W0|$l|}{URL CVE-2021-21705 - Fix #76448 Stack buffer overflow in firebird_info_cb - Fix #76449 SIGSEGV in firebird_handle_doer - Fix #76450 SIGSEGV in firebird_stmt_execute - Fix #76452 Crash while parsing blob data in firebird_fetch_blob CVE-2021-21704- fix snmp extension build with net-snmp without DES- Fix #80710 imap_mail_compose() header injection - use oracle client library version 21.1- Fix #80672 Null Dereference in SoapClient CVE-2021-21702 - better fix for #77423- Fix #77423 FILTER_VALIDATE_URL accepts URLs with invalid userinfo CVE-2020-7071- Core: Fix #79699 PHP parses encoded cookie names so malicious `__Host-` cookies can be sent CVE-2020-7070 - OpenSSL: Fix #79601 Wrong ciphertext/tag in AES-CCM encryption for a 12 bytes IV CVE-2020-7069 Fix bug #78079 openssl_encrypt_ccm.phpt fails with OpenSSL 1.1.1c- Core: Fix #79877 getimagesize function silently truncates after a null byte - Phar: Fix #79797 use of freed hash key in the phar_parse_zipfile function CVE-2020-7068- Core: Fix #78875 Long filenames cause OOM and temp files are not cleaned CVE-2019-11048 Fix #78876 Long variables in multipart/form-data cause OOM and temp files are not cleaned- standard: Fix #79330 shell_exec silently truncates after a null byte Fix #79465 OOB Read in urldecode CVE-2020-7067- standard: Fix #79329 get_headers() silently truncates after a null byte CVE-2020-7066 - exif: Fix #79282 Use-of-uninitialized-value in exif CVE-2020-7064 - use oracle client library version 19.6 (18.5 on EL-6)- dom: Fix #77569 Write Access Violation in DomImplementation - phar: Fix #79082 Files added to tar with Phar::buildFromIterator have all-access permissions CVE-2020-7063 - session: Fix #79221 Null Pointer Dereference in PHP Session Upload Progress CVE-2020-7062- mbstring: Fix #79037 global buffer-overflow in mbfl_filt_conv_big5_wchar CVE-2020-7060 - session: Fix #79091 heap use-after-free in session_create_id - standard: Fix #79099 OOB read in php_strip_tags_ex CVE-2020-7059- bcmath: Fix #78878 Buffer underflow in bc_shift_addsub CVE-2019-11046 - core: Fix #78862 link() silently truncates after a null byte on Windows CVE-2019-11044 Fix #78863 DirectoryIterator class silently truncates after a null byte CVE-2019-11045 - exif Fix #78793 Use-after-free in exif parsing under memory sanitizer CVE-2019-11050 Fix #78910 Heap-buffer-overflow READ in exif CVE-2019-11047 - use oracle client library version 19.5 (18.5 on EL-6)- Update to 7.1.33 - http://www.php.net/releases/7_1_33.php- Update to 7.1.32 - http://www.php.net/releases/7_1_32.php- Update to 7.1.31 - http://www.php.net/releases/7_1_31.php- use oracle client library version 19.3 - disable opcache.huge_code_pages in default configuration- Update to 7.1.30 - http://www.php.net/releases/7_1_30.php- Update to 7.1.29 - http://www.php.net/releases/7_1_29.php- Update to 7.1.28 - http://www.php.net/releases/7_1_28.php- Update to 7.1.27 - http://www.php.net/releases/7_1_27.php - add upstream patch for OpenSSL 1.1.1b- cleanup for EL-8- Update to 7.1.26 - http://www.php.net/releases/7_1_26.php- Fix null pointer dereference in imap_mail CVE-2018-19935- Update to 7.1.25 - http://www.php.net/releases/7_1_25.php- update to 7.1.25RC1- test build for https://github.com/php/php-src/pull/3666- Update to 7.1.24 - http://www.php.net/releases/7_1_24.php- FPM: add getallheaders, backported from 7.3- update to 7.1.24RC1- Update to 7.1.23 - http://www.php.net/releases/7_1_23.php- update to 7.1.23RC1 - use oracle client library version 18.3- Update to 7.1.22 - http://www.php.net/releases/7_1_22.php- update to 7.1.22RC1- Update to 7.1.21 - http://www.php.net/releases/7_1_21.php- Update to 7.1.20 - http://www.php.net/releases/7_1_20.php- update to 7.1.20RC1- Update to 7.1.19 - http://www.php.net/releases/7_1_19.php- update to 7.1.19RC1- Update to 7.1.18 - http://www.php.net/releases/7_1_18.php- rebuild against EL 7.5- update to 7.1.18RC1- Update to 7.1.17 - http://www.php.net/releax:XVx,$w -z now option) - Remove %config from /etc/rpm/macros.php- update to 5.4.11 - fix php.conf to allow MultiViews managed by php scripts- update to 5.4.10 - remove patches merged upstream - drop "Configure Command" from phpinfo output - prevent php_config.h changes across (otherwise identical) rebuilds- update to 5.4.9- fix php.conf- filter private shared in _httpd_modir - improve system libzip patch to use pkg-config - use _httpd_contentdir macro and fix php.gif path - switch back to upstream generated scanner/parser - use system pcre only when recent enough- improves php.conf, no need to be relocated- clarify Licenses - missing provides xmlreader and xmlwriter - change php embedded library soname version to 5.4- fix mysql_sock macro definition- fix standard build (non scl)- fix installed headers- use libldap_r for ldap extension- add missing scl_prefix in some provides/requires- make php-enchant optionnal, not available on RHEL-5 - make php-recode optionnal, not available on RHEL-5 - disable t1lib on RHEL-5- enable tidy on RHEL-6 only - re-enable unit tests- minor macro fixes for RHEL-5 build - update autotools workaround for RHEL-5 - use readline when libedit not available (RHEL-5)- update to 5.4.8 - define both session.save_handler and session.save_path - fix possible segfault in libxml (#828526) - use SKIP_ONLINE_TEST during make test - php-devel requires pcre-devel and php-cli (instead of php) - provides php-phar - update systzdata patch to v10, timezone are case insensitive- php-fpm: create apache user if needed - php-cli: provides cli command in standard root (scl)- add configtest option to init script - test configuration before service reload - fix php-fpm service relocation - fix php-fpm config relocation - drop embdded subpackage for scl- missing requires on scl-runtime - relocate /var/lib/session - fix php-devel requires - rename, but don't relocate macros.php- initial spec rewrite for scl build- fix typo in systemd macro- php-fpm: enable PrivateTmp - php-fpm: new systemd macros (#850268) - php-fpm: add upstream patch for startup issue (#846858)- systemd integration, https://bugs.php.net/63085 - no odbc call during timeout, https://bugs.php.net/63171 - check sqlite3_column_table_name, https://bugs.php.net/63149- most failed tests explained (i386, x86_64)- fix for http://bugs.php.net/63126 (#783967)- patch to ensure we use latest libdb (not libdb4)- really fix rhel tests (use libzip and libdb)- fix test to enable zip extension on RHEL-7- remove session.save_path from php.ini move it to apache and php-fpm configuration files- update to 5.4.7 http://www.php.net/releases/5_4_7.php - php-fpm: don't daemonize- enable php-fpm on secondary arch (#849490)- update to 5.4.6 - update to v9 of systzdata patch - backport fix for new libxml- update to 5.4.5- also provide php(language)%{_isa} - define %{php_version}- drop BR for libevent (#835671) - provide php(language) to allow version check- add missing provides (core, ereg, filter, standard)- update to 5.4.4 (CVE-2012-2143, CVE-2012-2386) - use /usr/lib/tmpfiles.d instead of /etc/tmpfiles.d - use /run/php-fpm instead of /var/run/php-fpm- update to 5.4.3 (CVE-2012-2311, CVE-2012-2329)- update to 5.4.2 (CVE-2012-1823)- update to 5.4.1- rebuild for new icu - switch (conditionally) to libdb-devel- fix Loadmodule with MPM event (use ZTS if not MPM worker) - split conf.d/php.conf + conf.modules.d/10-php.conf with httpd 2.4- rebuild for missing automatic provides (#807889)- really use _httpd_mmn- rebuild against httpd 2.4 - use _httpd_mmn, _httpd_apxs macros- update to PHP 5.4.0 finale- update to PHP 5.4.0RC8- update to PHP 5.4.0RC7 - provides env file for php-fpm (#784770) - add patch to use system libzip (thanks to spot) - don't provide INSTALL file- all binaries in /usr/bin with zts prefix- update to PHP 5.4.0RC6 https://fedoraproject.org/wiki/Features/Php54- fix systemd unit- switch to systemd- Rebuild for new libpng- rebuild with new gmp without compat lib- rebuild with new gmp- revert x(*XWp=+$;+*C.?-d" - fIV bn     <p4(8f9f:fG)H)I)X)Y)\*]* ^*b+d,`e,ef,hl,jt,u,v,w- x-8y-P-----_ .;_ ....g.h.Cphp56-php-ioncube-loader13.0.41.el7.remiLoader for ionCube Encoded Files with ionCube 24 supportLoader for ionCube Encoded Files with ionCube 24 support. Package built for PHP 5.6 as Software Collection (php56 by remi).fYbuilder.remirepo.netRemi's RPM repository #StandWithUkraineDistribuableRemi ColletUnspecifiedhttp://www.ioncube.comlinuxx86_645(<*<)A큤A큤fYfYvfYfYfYfYd8dbb669600c0af25f05b14bee60de68fa5b1a4c550deba5323aa6f937be4a47d814c6dd5cd6dac48f0f510a44cb9e10a811bd1e3bd06ebbc61d987eea97655e26e575fe1e948a30ce8dc561ca52634cc4116ad678ab0b9e9d165de700bd051b9224a5a719d86c8b7e3f1da7f4c64b229d9bdc9909dca43cc4958756a6c03c16rootrootrootrootrootrootrootrootrootrootrootrootphp56-php-ioncube-loader-13.0.4-1.el7.remi.src.rpmconfig(php56-php-ioncube-loader)php56-php-ioncube-loaderphp56-php-ioncube-loader(x86-64)scl-package(php56)@@@@@@@    config(php56-php-ioncube-loader)libc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.4)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.2.5)(64bit)php56-php(api)php56-php(zend-abi)php56-runtimephp56-runtime(remi)(x86-64)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)13.0.4-1.el7.remi20131106-6420131226-643.0.4-14.6.0-14.0-15.2-14.11.3fYfDe@d@dcci@c.c pbbL@ba@av@_G@_{ _X_N7__^)@^\@^W@]n]bx@]^@] #\@\7\-@\(@\ @[@[v[ @[ug@[P}@[,ZK@Z%Z`@Z_:Z3@YY˒Y@Y@@YY@Y%uXXRXD@X@W1@W W@Wڍ@V@V1V@V@V@VvV0V&,U@UpUM@UUUnUU3@UJ@UUUU`kU[%UXUPUG_@U?v@T@TTܕTTp@TsTSyTBV@T?@T_SVYSAASK@RlR2@Rbt@R6Q4PDRemi Collet - 13.0.4-1Remi Collet - 13.0.3-1Remi Collet - 13.0.2-1Remi Collet - 13.0.1-1Remi Collet - 13.0.0-1Remi Collet - 12.0.5-1Remi Collet - 12.0.4-1Remi Collet - 12.0.3-1Remi Collet - 12.0.2-1Remi Collet - 12.0.1-2Remi Collet - 12.0.1-1Remi Collet - 12.0.0-1Remi Collet - 11.0.1-1Remi Collet - 11.0.0-1Remi Collet - 10.4.5-1Remi Collet - 10.4.4-1Remi Collet - 10.4.3-1Remi Collet - 10.4.2-1Remi Collet - 10.4.1-2Remi Collet - 10.4.1-1Remi Collet - 10.4.0-1Remi Collet - 10.4.0~beta2-1Remi Collet - 10.4.0~beta1-1Remi Collet - 10.3.9-1Remi CollexXW(vS$CSTRe ttmkfdir inclusion conditional, and set up a define to include ttmkfdir in RHL 7.x builds, since ttmkfdir is now moving to the new XFree86-font-utils package.- Updated freetype to version 2.0.6- automated rebuild- Fix bug #56901 (ttmkfdir needed to list Unicode encoding when generating font list). (ttmkfdir-iso10646.patch) - Use _smp_mflags macro everywhere relevant. (freetype-pre1.4-make.patch) - Undo fix for #24253, assume compiler was fixed.- Fix build with gcc 3.1 (#56079)- Updated freetype to version 2.0.5- Added new subpackage freetype-demos, added demos to build - Disabled ftdump, ftlint in utils package favoring the newer utils in demos package.- Updated source to 2.0.4 - Added freetype demo's back into src.rpm, but not building yet.- Changed package to use {findlang} macro to fix bug (#50676)- Changed freetype-devel to group Development/Libraries (#47625)- Fix up FT1 headers to please Qt 3.0.0 beta 2- Add ft2build.h to -devel package, since it's included by all other freetype headers, the package is useless without it- Change "Requires: freetype = name/ver" to "freetype = version/release", and move the requirements to the subpackages.- Added "Requires: freetype = name/ver"- Updated to Freetype 2.0.3, minor specfile tweaks. - Freetype2 docs are is in a separate tarball now. Integrated it. - Built in new environment.- rebuild for C++ exception handling on ia64- Build ttmkfdir with -O0, workaround for Bug #24253- libtool is used to build libttf, so use libtool to link ttmkfdir with it - fixup a paths for a couple of missing docs- Update ttmkfdir- Update to 2.0.1 and 1.4 - Mark locale files as such- automatic rebuild- move .la file to devel pkg - FHS paths- revert spaces patch, fix up some foundry names to match X ones- add defattr, ftmetric, ftsbit, ftstrtto per bug #9174- fix description and summary- make ttmkfdir replace spaces in family names with underscores (#7613)- 1.3.1 - handle RPM_OPT_FLAGS- fix a path for ttmkfdir Makefile- newer ttmkfdir that works better, moved ttmkfdir to /usr/bin from /usr/sbin - freetype utilities moved to subpkg, X dependency removed from main pkg - libttf.so symlink moved to devel pkg- strip binaries- auto rebuild in the new build environment (release 5)- fixed the doc file list- Injected new description and group.- added ttmkfdir- update to 1.2- call libtoolize to sanitize config.sub and get ARM support - dispoze of the patch (not necessary anymore)- post/postun sections for ldconfig action.- initial RPM, includes normal and development packages.  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~x XV0j$Hjjjcek 4.8.5-27Jeff Law 4.8.5-26Jeff Law 4.8.5-25Jeff Law 4.8.5-24Marek Polacek 4.8.5-23Marek Polacek 4.8.5-22Marek Polacek 4.8.5-21Marek Polacek 4.8.5-20Jeff Law 4.8.5-19Marek Polacek 4.8.5-18Marek Polacek 4.8.5-17Marek Polacek 4.8.5-16Marek Polacek 4.8.5-15Marek Polacek 4.8.5-14Jakub Jelinek 4.8.5-13Jakub Jelinek 4.8.5-12Jakub Jelinek 4.8.5-11Jakub Jelinek 4.8.5-10Jakub Jelinek 4.8.5-9Jakub Jelinek 4.8.5-8Jakub Jelinek 4.8.5-7Jakub Jelinek 4.8.5-6Jakub Jelinek 4.8.5-5Jakub Jelinek 4.8.5-4Jakub Jelinek 4.8.5-3Jakub Jelinek 4.8.5-2Jakub Jelinek 4.8.5-1Richard Henderson 4.8.3-9Jakub Jelinek 4.8.3-8Jakub Jelinek 4.8.3-7Jakub Jelinek 4.8.3-6Richard Henderson 4.8.3-5Jakub Jelinek 4.8.3-4Jakub Jelinek 4.8.3-3Jakub Jelinek 4.8.3-2Jakub Jelinek 4.8.3-1Jakub Jelinek 4.8.2-18Jakub Jelinek 4.8.2-17Jakub Jelinek 4.8.2-16Jakub Jelinek 4.8.2-15Jakub Jelinek 4.8.2-14Jakub Jelinek 4.8.2-13Jakub Jelinek 4.8.2-12Jakub Jelinek 4.8.2-11Jakub Jelinek 4.8.2-10Jakub Jelinek 4.8.2-9Jakub Jelinek 4.8.2-8Jakub Jelinek 4.8.2-7Jakub Jelinek 4.8.2-6Jakub Jelinek 4.8.2-5Jakub Jelinek 4.8.2-4Jakub Jelinek 4.8.2-3Jakub Jelinek 4.8.2-2Jakub Jelinek 4.8.2-1Jakub Jelinek 4.8.1-12Jakub Jelinek 4.8.1-11Jakub Jelinek 4.8.1-10Jakub Jelinek 4.8.1-9Jakub Jelinek 4.8.1-8Jakub Jelinek 4.8.1-7Jakub Jelinek 4.8.1-6Jakub Jelinek 4.8.1-5Jakub Jelinek 4.8.1-4Jakub Jelinek 4.8.1-3Jakub Jelinek 4.8.1-2Jakub Jelinek 4.8.1-1Jakub Jelinek 4.8.0-8Jakub Jelinek 4.8.0-7Jakub Jelinek 4.8.0-6Jakub Jelinek 4.8.0-5Jakub Jelinek 4.8.0-4Jakub Jelinek 4.8.0-3Jakub Jelinek 4.8.0-2Jakub Jelinek 4.8.0-1Jakub Jelinek 4.8.0-0.18Jakub Jelinek 4.8.0-0.17Jakub Jelinek 4.8.0-0.16Jakub Jelinek 4.8.0-0.15Jakub Jelinek 4.8.0-0.14Jakub Jelinek 4.8.0-0.13Jakub Jelinek 4.8.0-0.12Jakub Jelinek 4.8.0-0.11Jakub Jelinek 4.8.0-0.10Jakub Jelinek 4.8.0-0.9Jakub Jelinek 4.8.0-0.8Jakub Jelinek 4.8.0-0.7Jakub Jelinek 4.8.0-0.6Jakub Jelinek 4.8.0-0.5Jakub Jelinek 4.8.0-0.4Jakub Jelinek 4.8.0-0.3- fix pr92950.c test (#1784759)- fix wrong code emitted for movv1qi on s390x (#1784759) - fix wrong code with EH due to a bug in LRA (#1800526)- avoid folding shifts of vector types (#1740539)- backport ARMv8.3 pointer authentication patches (#1769573)- fix ICE with lambda in NSDMI (PR c++/66585, #1713056) - revert thx@XXX$juires- disable zip extension per "No Bundled Libraries" policy (#551513)- rebuild for icu 4.6- fix systemd-units requires- add tmpfiles.d configuration for php-fpm - add Arch specific requires/provides- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- update to 5.3.5 http://www.php.net/ChangeLog-5.php#5.3.5 - clean duplicate configure options- rebuild against MySQL 5.5.8 - remove all RPM_SOURCE_DIR- security patch from upstream for #660517- update to 5.3.4 http://www.php.net/ChangeLog-5.php#5.3.4 - move phpize to php-cli (see #657812)- ghost /var/run/php-fpm (see #656660) - add filter_setup to not provides extensions as .so- use mysql_config in libdir directly to avoid biarch build failures- rebuild for new net-snmp- add php-fpm sub-package- PHP 5.3.3 released- garbage collector upstream patches (#580236)- rebuild for icu 4.4- PHP 5.3.2 Released! - remove mime_magic option (now provided by fileinfo, by emu) - add patch for http://bugs.php.net/50578 - remove patch for libedit (upstream) - add runselftest option to allow build without test suite- update to v7 of systzdata patch- fix build with autoconf 2.6x- update to 5.3.1 - remove openssl patch (merged upstream) - add provides for php-pecl-json - add prod/devel php.ini in doc- use libedit instead of readline to resolve licensing issues- rebuilt with new openssl- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- rediff systzdata patch- update to v6 of systzdata patch; various fixes- update to v5 of systzdata patch; parses zone.tab and extracts timezone->{country-code,long/lat,comment} mapping table- update to 5.3.0 - remove ncurses, dbase, mhash extensions - add enchant, sqlite3, intl, phar, fileinfo extensions - raise sqlite version to 3.6.0 (for sqlite3, build with --enable-load-extension) - sync with upstream "production" php.ini- update to 5.2.10 - add interbase sub-package- update to 5.2.9- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- add recode support, -recode subpackage (#106755) - add -zts subpackage with ZTS-enabled build of httpd SAPI - adjust php.conf to use -zts SAPI build for worker MPM- fix patch fuzz, renumber patches- drop obsolete configure args - drop -odbc patch (#483690)- split out sysvshm, sysvsem, sysvmsg, posix into php-process- move wddx to php-xml, build curl shared in -common - remove BR for expat-devel, bogus configure option- rebuild for new MySQL- libtool 2 workaround for phpize (#476004) - add missing php_embed.h (#457777)- update to 5.2.8- libtool 2 workaround- update to 5.2.7 - enable pdo_dblib driver in php-mssql- tweak Summary, thanks to Richard Hughes- move gd_README to php-gd - update to r4 of systzdata patch; introduces a default timezone name of "System/Localtime", which uses /etc/localtime (#469532)- enable XPM support in php-gd - Fix BR for php-gd- enable T1lib support in php-gd- update to 5.2.6 - sync default php.ini with upstream - drop extension_dir from default php.ini, rely on hard-coded default, to make php-common multilib-safe (#455091) - update to r3 of systzdata patch- split pspell extension out into php-spell (#443857)- Autorebuild for GCC 4.3- ext/date: use system timezone database- rebuild for libc-client bump- Rebuild for openssl bump- update to 5.2.5- correct pcre BR version (#333021) - restore metaphone fix (#205714) - add READMEs to php-cli- update to 5.2.4- rebuild for fixed APR- add ldconfig post/postun for -embedded (Hans de Goede)- add php-embedded sub-package- fix build with new glibc - fix License- define php_extdir in macros.php- obsolete php-dbase- add mcrypt, mhash, tidy, mssql subpackages (Dmitry Butskoy) - enable dbase extension and package in -common- update to 5.2.3 (thanks to Jeff Sheltren)- fix php-pdo *_arg_force_ref global symbol abuse (#216125)- rebuild against uw-imap-devel- update to 5.2.2 - synch changes from upstream recommended php.ini- enable SASL support in LDAP extension (#205772)- drop mime_magic extension (deprecated by php-pecl-FixXWH+r $br q Bp?Xd   6<@X\ct    8 % &H(h+--/M7C9C>|C(>8?V9@\V:O;VG]H_<Ia\XaMYcM\dH]fh^obrdsjesofsrlsttsuuvw wyhx{y}+Thl  dghhlCperl-DBI1.6274.el7A database access API for perlDBI is a database access Application Programming Interface (API) for the Perl Language. The DBI API Specification defines a set of functions, variables and conventions that provide a consistent database interface independent of the actual database being used.SZworker1.bsys.centos.orgCentOSGPL+ or ArtisticCentOS BuildSystem Development/Librarieshttp://dbi.perl.org/linuxx86_64b/Pv;b M1 $Lr_-8%m> ; lj(yF^~N(g\'t =eVp w$l R . v <7w"T#  ) 5  Ikj %+<*C BA큤A큤A큤A큤A큤A큤A큤AA큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤A큤SZ'SZ'SZ'SZ-Q]SZ-QSXQ]SZ-Q]Q]Q]Q]SZ-SZ'SZ-Q]Q]Q]Q]SZ-Q]Q]Q]Q]Q]SZ'Q]SZ.Q0SZ'SZ-SZ-Q]Q]Q]Q]SZ-Q]Q]SZ-QSXQSXQ]Q]SZ-Q]Q]Q]SZ-Q]Q]Q]SZ-Q]Q]Q]Q]Q]SZ-Q]Q]Q]SZ'Q]SZ-Q0USZ-Q]Q]SZ.SZ.Q]Q]Q]Q]Q]Q]Q]Q]SZ.SZQ^ASZ'SZ'Q]Q]SZ+SZ+SZ+SZ-SZ+SZ,SZ-SZ,SZ+SZ,SZ,SZ,SZ,SZ,SZ,SZ-SZ+SZ,SZ+SZ,SZ,SZ,SZ+SZ,SZ+SZ-SZ+SZ-SZ,SZ,SZ,SZ-SZ,SZ+SZ-SZ+SZ,SZ+SZ,SZ,SZ-SZ-SZ-SZ+SZ,SZ-SZ-SZ,SZ,79a07a3d3fbcb76fed918ebdeb31a94a6ab216b7abe483c17b68f96e90e3bce66a09d553de264d164c74454b11d5aeaa76752f126f6049e145309f79b25f365ec3e0e039c9608859ca88f78f016e14ceba5238921cda0f2fdf0c33ba7b958875becb23980cdca5999490829049d7bd12d13ae203ee9a52ceded0a0ef9746d49310eb5901987529b20b21859c7fd4e1cd351180d4a600b667775dc9f8e51fa6ccf0e8a55f034aa2109a4ef7e03d7f5d90f86ff82c87680183d54ac0361378ac31b28e9b67a7a6ddae6aa563b28a556865761289f0af78ae08fd2a548aaf94fb11133b3fb2f65aa9a5e2d1be30394b343f38a14eb82323bcfeda61c44fa11bb24bd35fc49add31309c248cd0a8fa1554c8d1fcad19dd98ad69a2428ac21ba2c548b53a8cc1b71926ec77bd086a4668d6376d72bc6ed1ddf97aaca982012c55e82e5683e7369f4555e9146f74bb4df7b8090c97e1a0e093dfb68c81a81edac157e30570e2c7236daa665e27a6a172a995fbb1f069698ccfdb7dc4ded59776bd98e5d52536e66beaf709b84c3523d8fd8485c2799c66328e796fdcb73a734b55bddd609dd88f9c53e203b7cb2a6e5e5e5c3721a3868af19a407c6e00xXW@ $j 0.1-7Remi Collet - 1.0.1-6Remi Collet - 1.0.1-5Remi Collet - 1.0.1-4Remi Collet - 1.0.1-3Remi Collet - 1.0.1-2Remi Collet - 1.0.1-1- update to 1.0.7 (no change)- build out of sources tree- update to 1.0.6 (no change)- update to 1.0.5- rebuild for 8.1.0RC1- add upstream patch for test suite with PHP 8.1 - run tests in parallel (7.4+)- F34 rebuild for https://github.com/remicollet/remirepo/issues/174- update to 1.0.4- add upstream patches for PHP 8- update to 1.0.3 (no change)- rebuild for 7.4.0RC1- rebuild for 7.4.0beta1- fix upgrade patch from other 3rd party repo- update to 1.0.2- rebuild for 7.3.0beta2 new ABI- rebuild for 7.3.0alpha4 new ABI- manage update from other 3rd party repo- use run-tests.php instead of make test- rebuild for PHP 7.2.0beta1 new API- drop .so extension for configuration file- rebuild for 7.2.0alpha2- New spec for version 1.0.1 (PHP 7.2)/bin/shphp81-php-mcrypt/bin/sh1.0.7-1.el7.remi1:1.0.7-1.el7.remi1:1.0.7-1.el7.remi1.0.71.0.71.0.7-1.el7.remi1.0.7-1.el7.remi7.230-mcrypt.inimcrypt.sophp81-php-pecl-mcrypt-1.0.7LICENSEphp81-php-pecl-mcrypt.xml/etc/opt/remi/php81/php.d//opt/remi/php81/root/usr/lib64/php/modules//opt/remi/php81/root/usr/share/licenses//opt/remi/php81/root/usr/share/licenses/php81-php-pecl-mcrypt-1.0.7//var/opt/remi/php81/lib/pear/pkgxml/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=184d0a18834ebe6e97c229d68b4ca4a7b8225fb1, strippeddirectoryXML 1.0 document, ASCII text, with very long lines RRRRRRPR PR PR if [ -x /opt/remi/php81/root/usr/bin/pecl ] ; then /opt/remi/php81/root/usr/bin/pecl install --nodeps --soft --force --register-only --nobuild /var/opt/remi/php81/lib/pear/pkgxml/php81-php-pecl-mcrypt.xml >/dev/null || : fi/bin/shhttps://forum.remirepo.net/?]``5zI 7z/q]!LΈJ]NoGVe NoGVJHkӞVCY}etçhh Дc+іX]!LΈJ]NoGVe NoGV H0C"*h;&' cB531989269b4329d748023874a5e47a0fde1e9d12g v,g u3343 1299140 1307091 1312828 1320563 1340839] - [md] raid1: include bio_end_io_list in nr_queued to prevent freeze_array hang (Jes Sorensen) [1250578 1265947 1273343 1299140 1307091 1312828 1320563 1340839] - [md] fix typos for stipe (Jes Sorensen) [1250578 1265947 1273343 1299140 1307091 1312828 1320563 1340839] - [md] bitmap: remove redundant return in bitmap_checkpage (Jes Sorensen) [1250578 1265947 1273343 1299140 1307091 1312828 1320563 1340839] - [md] raid1: remove unnecessary BUG_ON (Jes Sorensen) [1250578 1265947 1273343 1299140 1307091 1312828 1320563 1340839] - [md] raid5: output stripe state for debug (Jes Sorensen) [1250578 1265947 1273343 1299140 1307091 1312828 1320563 1340839] - [md] raid5: preserve STRIPE_PREREAD_ACTIVE in break_stripe_batch_list (Jes Sorensen) [1250578 1265947 1273343 1299140 1307091 1312828 1320563 1340839] - [md] bitmap: remove redundant check (Jes Sorensen) [1250578 1265947 1273343 1299140 1307091 1312828 1320563 1340839] - [md] Drop sending a change uevent when stopping (Jes Sorensen) [1250578 1265947 1273343 1299140 1307091 1312828 1320563 1340839] - [md] raid5: revert e9e4c377e2f563 to fix a livelock (Jes Sorensen) [1250578 1265947 1273343 1299140 1307091 1312828 1320563 1340839] - [md] raid5: check_reshape() shouldn't call mddev_suspend (Jes Sorensen) [1250578 1265947 1273343 1299140 1307091 1312828 1320563 1340839] - [md] raid5: Compare appxXM`U `$>` p xsgbVQE@4/# ythcWRFA50$ z u i d X S G B 6 1 %    { v j e Y T H C 7 2 & !    | w k f Z U I D 8 3 ' "    } x l g [ V J E 9 4 ( #     ~ y m h \ W K F : 5 ) $     zni]XLG;6*%{oj^YMH<7+& |pk_ZNI=8,' }ql`[OJ>9-( ~rma\PK?:.) swebazolver. vringh.ko.xzyum-d\utimCucode_w                                              ~]di K  Mǂ п}.c$P$ () :v Oq,v7+v+T3~MuuU(a܅TVSu+JN apE)# k(It  eaB'jl9 Ca9P0#`X'G hiB,xE%2IY @JiD<3I^P8/t^a 41!~3"whvi"p10n lHj4fOh`1h0_\^L?\pZ -Y1p"WΌV(<T%R'DQQ1DO}N0-M(LI]1iGFt/E0DI$#B3A0?o1>$=`$<:T9076*53C4P2q104/.t-K*3)&($:>"`!| )1H,wn(?})J(4'}n   d 0l}h= p\,~dxpXV SI$IIIdate to 0.8.1 release candidate - core: fix WWAN hardware enable state tracking (rh #591622) - core: fix Red Hat initscript return value on double-start (rh #584321) - core: add multicast route entry for IPv4 link-local connections - core: fix connection sharing in cases where a dnsmasq config file exists - core: fix handling of Ad-Hoc wifi connections to indicate correct network - core: ensure VPN interface name is passed to dispatcher when VPN goes down - ifcfg-rh: fix handling of ASCII WEP keys - ifcfg-rh: fix double-quoting of some SSIDs (rh #606518) - applet: ensure deleted connections are actually forgotten (rh #618973) - applet: don't crash if the AP's BSSID isn't availabe (rh #603236) - editor: don't crash on PolicyKit events after windows are closed (rh #572466)- core: fix nm-online crash (rh #593677) - core: fix failed suspend disables network (rh #589108) - core: print out missing firmware errors (rh #594578) - applet: fix device descriptions for some mobile broadband devices - keyfile: bluetooth fixes - applet: updated translations (rh #589230)- core: use GIO in local mode only (rh #588745) - core: updated translations (rh #589230) - core: be more lenient in IPv6 RDNSS server expiry (rh #590202) - core: fix headers to be C++ compatible (rh #592783) - applet: updated translations (rh #589230) - applet: lock connections with well-known SSIDs to their specific AP- core: fix handling of IPv6 RA flags when router goes away (rh #588560) - bluetooth: fix crash configuring DUN connections from the wizard (rh #590666)- core: restore initial accept_ra value for IPv6 ignored connections (rh #588619) - bluetooth: fix bad timeout on PAN connections (rh #586961) - applet: updated translations- core: treat missing IPv6 configuration as ignored (rh #588814) - core: don't flush IPv6 link-local routes (rh #587836) - cli: update output formatting- core: allow IP configuration as long as one method completes (rh #567978) - core: don't prematurely remove IPv6 RDNSS nameservers (rh #588192) - core: ensure router advertisements are only used when needed (rh #588613) - editor: add IPv6 gateway editing capability- core: IPv6 autoconf, DHCP, link-local, and manual mode fixes - editor: fix saving IPv6 address in user connections- core: fix crash when IPv6 is enabled and interface is deactivated- core: fix issues with IPv6 router advertisement mishandling (rh #530670) - core: many fixes for IPv6 RA and DHCP handling (rh #538499) - core: ignore WWAN ethernet devices until usable (rh #585214) - ifcfg-rh: fix handling of WEP passphrases (rh #581718) - applet: fix crashes (rh #582938) (rh #582428) - applet: fix crash with multiple concurrent authorization requests (rh #585405) - editor: allow disabling IPv4 on a per-connection basis - editor: add support for IPv6 DHCP-only configurations- core: fix crash during install (rh #581794) - wifi: fix crash when supplicant segfaults after resume (rh #538717) - ifcfg-rh: fix MTU handling for wired connections (rh #569319) - applet: fix display of disabled mobile broadband devices- core: fix automatic WiFi connections on resume (rh #578141)- core: more flexible logging - core: fix crash with OLPC mesh devices after suspend - applet: updated translations - applet: show mobile broadband signal strength and technology in the icon - applet: fix continuous password requests for 802.1x connections (rh #576925) - applet: many updated translations- core: fix modem enable/disable - core: fix modem default route handling- core: don't exit early on non-fatal state file errors - core: fix Bluetooth connection issues (rh #572340) - applet: fix some translations (rh #576056) - applet: better feedback when wrong PIN/PUK is entered - applet: many updated translations - applet: PIN2 unlock not required for normal modem functionality - applet: fix wireless secrets dialog display- man: many manpage updates - core: determine classful prefix if non is given via DHCP - core: ensure /etc/hosts is always up-to-date and correct (rh #569914) - core: support GSM network and roaming prefxXVAZa$JZa[aH*H?%d! ( Y !( $ 0 H  H`(8 9 : >!@)G4HLIdXlY\$]<^b defltuv wxy#%%%%' ' **0*4*<g*@h*DCurw-base35-z003-fonts2017080110.el7Z003 font family [part of Level 2 Core Font Set]This package contains Z003 font family, which is part of Level 2 Core Font Set. The Level 2 Core Font Set is a PostScript specification of 35 base fonts that can be used with any PostScript file. In Fedora, these fonts are provided freely by (URW)++ company, and are mainly utilized by applications using Ghostscript.]Qx86-02.bsys.centos.orgCentOSAGPLv3CentOS BuildSystem Unspecifiedhttps://www.urwpp.de/en/linuxnoarch ( if ! [[ -x /var/lib/rpm-state/urw-base35-fonts/cache-update-needed ]]; then rm -rf /var/lib/rpm-state/urw-base35-fonts mkdir -p /var/lib/rpm-state/urw-base35-fonts touch /var/lib/rpm-state/urw-base35-fonts/cache-update-needed chmod +x /var/lib/rpm-state/urw-base35-fonts/cache-update-needed fi ) ( if [[ $1 -eq 0 ]]; then # mkfontscale /usr/share/fonts/urw-base35 &> /dev/null || : # mkfontdir /usr/share/fonts/urw-base35 &> /dev/null || : # xset fp rehash &> /dev/null || : true || : fi )1aM]Q]QYYYYd9cea9d00373e76ce4f2214dd84aef7498abc54faff902a3c8414acecd2776e4f432bc765828b4b18e49a9f3d99fcd7af67dff9394a16f4ea2a129fbd53dc364b6c1253e5810cbfbf178373a8f2e3bb01f4215662779b3cca38656f4fb13ad50a04947e59fc9339ea3c4b34c31fd46764f22af7512afc2c074ce190e79ed7a0984ff513d45b7255ddc1ac0bad4b03b1a0fd055f9093617034b59d333ec77b1b6/usr/share/fontconfig/conf.avail/61-urw-z003.confrootrootrootrootrootrootrootrootrootrootrootrooturw-base35-fonts-20170801-10.el7.src.rpmfont(:lang=aa)font(:lang=af)font(:lang=an)font(:lang=av)font(:lang=ay)font(:lang=ba)font(:lang=be)font(:lang=bg)font(:lang=bi)font(:lang=br)font(:lang=bs)font(:lang=bua)font(:lang=ca)font(:lang=ce)font(:lang=ch)font(:lang=co)font(:lang=crh)font(:lang=cs)font(:lang=csb)font(:lang=cy)font(:lang=da)font(:lang=de)font(:lang=el)font(:lang=en)font(:lang=eo)font(:lang=es)font(:lang=et)font(:lang=eu)font(:lang=fi)font(:lang=fil)font(:lang=fj)font(:lang=fo)font(:lang=fr)font(:lang=fur)font(:lang=fy)font(:lang=gd)font(:lang=gl)font(:lang=gv)font(:lang=ho)font(:lang=hr)font(:lang=hsb)font(:lang=ht)font(:lang=hu)font(:lang=ia)font(:lang=id)font(:lang=ie)font(:lang=ik)font(:lang=io)font(:lang=is)font(:lang=it)font(:lang=jv)font(:lang=kaa)font(:lang=ki)font(:lang=kj)font(:lang=kk)font(:lang=kl)font(:lang=ku-tr)font(:lang=kum)font(:lang=kwm)font(:lang=ky)font(:lang=la)font(:lang=lb)font(:lang=lez)font(:lang=lg)font(:lang=li)font(:lang=lt)font(:lang=lv)fontx`XVj$rjjfHb2Iuy LĠ|x.yL]=6qxgVV!=f!̤`.+:<3y3]v_Lᱪ;բKh#юWҊ/jSKA-6.?4}S紨g4Y6hf{IO*?/x!= 6qz׈C1i.wLHdA=e)ʅF#):uà {%e BoH')T=8r_I7$ƨ?>^!'+> 8t]&S!i#1YE|hA$`!Fcj3c\l) liNt"@DC?lxlڒyiѣ}1pL=En}K6RsMy)FGP8Φ$癍yq o^TQ; j֗  ԁ{} - 7.3.1-2Remi Collet - 7.3.1-1Remi Collet - 7.3.1~RC1-1Remi Collet - 7.3.0-1Remi Collet - 7.3.0~rc6-1Remi Collet - 7.3.0~rc5-1Remi Collet - 7.3.0~rc4-2Remi Collet - 7.3.0~rc4-1Remi Collet - 7.3.0~rc3-1Remi Collet - 7.3.0~rc2-1Remi Collet - 7.3.0~rc1-1Remi Collet - 7.3.0~beta3-3Remi Collet - 7.3.0~beta3-2Remi Collet - 7.3.0~beta3-1Remi Collet - 7.3.0~beta2-1Remi Collet - 7.3.0~alpha4-1Remi Collet - 7.3.0~alpha3-1Remi Collet - 7.3.0~alpha2-2Remi Collet - 7.3.0~alpha2-1Remi Collet - 7.3.0~alpha1-1Remi Collet - 7.2.7~RC1-1Remi Collet - 7.2.6-1Remi Collet - 7.2.6~RC1-2Remi Collet - 7.2.6~RC1-1Remi Collet - 7.2.5-1Remi Collet - 7.2.5~RC1-1Remi Collet - 7.2.4-2Remi Collet - 7.2.4-1Remi Collet - 7.2.4~RC1-2Remi Collet - 7.2.4~RC1-1Remi Collet - 7.2.3-2Remi Collet - 7.2.3-1Remi Collet - 7.2.3~RC1-3Remi Collet - 7.2.3~RC1-2Remi Collet - 7.2.2-1Remi Collet - 7.2.2~RC1-1Remi Collet - 7.2.1-1Remi Collet - 7.2.1~RC1-2Remi Collet - 7.2.1~RC1-1Remi Collet - 7.2.0-1Remi Collet - 7.2.0-0.31.RC6Remi Collet - 7.2.0-0.30.RC5Remi Collet - 7.2.0-0.29.RC4Remi Collet - 7.2.0-0.28.RC4Remi Collet - 7.2.0-0.27.RC3Remi Collet - 7.2.0-0.26.RC3Remi Collet - 7.2.0-0.25.RC3Remi Collet - 7.2.0-0.24.RC2Remi Collet - 7.2.0-0.23.RC2Remi Collet - 7.2.0-0.22.RC1Remi Collet - 7.2.0-0.21.RC1Remi Collet - 7.2.0-0.19.20170827.c22cda5Remi Collet - 7.2.0-0.18.20170828.cc57774Remi Collet - 7.2.0-0.17.20170822.3fff74aRemi Collet - 7.2.0-0.16.beta3Remi Collet - 7.2.0-0.15.beta2Remi Collet - 7.2.0-0.14.beta2Remi Collet - 7.2.0-0.13.beta1Remi Collet - 7.2.0-0.12.20170611.249f75eRemi Collet - 7.2.0-0.11.alpha3Remi Collet - 7.2.0-0.9.alpha2Remi Collet - 7.2.0-0.8.alpha1Remi Collet - 7.2.0-0.7.20170602.a86c87dRemi Collet - 7.2.0-0.6.20170529.37a16a3Remi Collet - 7.2.0-0.5.alpha0Remi Collet - 7.2.0-0.4.20170516.0722a01Remi Collet - 7.2.0-0.3.20170504.5af997eRemi Collet - 7.2.0-0.2.20170424.eb68c0dRemi Collet - 7.2.0-0.1.20170412.efeab78Remi Collet - 7.1.4-1Remi Collet - 7.1.4-0.1.RC1Remi Collet - 7.1.3-1Remi Collet - 7.1.3-0.2.RC1Remi Collet - 7.1.3-0.1.RC1Remi Collet - 7.1.2-1Remi Collet - 7.1.2-0.2.RC1Remi Collet 7.1.2-0.1.RC1Remi Collet 7.1.1-3Remi Collet 7.1.1-2Remi Collet 7.1.1-1Remi Collet 7.1.1-0.1.RC1Remi Collet 7.1.0-2Remi Collet 7.1.0-1Remi Collet ?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~86950.08143100.41153261008710087100871008714120100871008714598147140.2004100021.6278696113738696869612.142130.061493414282125361156599499949155851253612536125361506410007153241412093950.3005155431031494781.627-4.el71.627-4.el7    dbilogstripdbiprofdbiproxyBundleDBI.pmDBDDBM.pmExampleP.pmFileFile.pmDevelopers.podHowTo.podRoadmap.podGoferGofer.pmPolicyBase.pmclassic.pmpedantic.pmrush.pmTransportBase.pmnull.pmpipeone.pmstream.pmNullP.pmProxy.pmSponge.pmDBIDBI.pmChanges.pmConstGetInfoANSI.pmODBC.pmGetInfoReturn.pmGetInfoType.pmDBDDBD.pmMetadata.pmSqlEngineSqlEngine.pmDevelopers.podHowTo.podFAQ.pmGoferExecute.pmRequest.pmResponse.pmSerializerBase.pmDataDumper.pmStorable.pmTransportBase.pmpipeone.pmstream.pmProfile.pmProfileData.pmProfileDumperProfileDumper.pmApache.pmProfileSubs.pmProxyServer.pmPurePerl.pmSQLNano.pmUtilCacheMemory.pm_accessor.pmDBIDBI.soDBIXS.hDriver.xstDriver_xst.hdbd_xsh.hdbi_sql.hdbipport.hdbivport.hdbixs_rev.hdbixs_rev.plperl-DBI-1.627README.mdexcorogofer.plperl_dbi_nulls_test.plprofile.pldbilogstrip.1.gzdbiprof.1.gzdbiproxy.1.gzBundle::DBI.3pm.gzDBD::DBM.3pm.gzDBD::File.3pm.gzDBD::File::Developers.3pm.gzDBD::File::HowTo.3pm.gzDBD::File::Roadmap.3pm.gzDBD::Gofer.3pm.gzDBD::Gofer::Policy::Base.3pm.gzDBD::Gofer::Policy::classic.3pm.gzDBD::Gofer::Policy::pedantic.3pm.gzDBD::Gofer::Policy::rush.3pm.gzDBD::xcXU x<$7<<<cycle(#525402) - ls: print "?", not "0" as inode of dereferenced dangling symlink(#525400) - call the install-info on .gz info files- improve and correct runuser documentation (#524805)- add dircolors color for GNU lzip (#516897)- fixed typo in DIR_COLORS.256color causing no color for multihardlink- fix copying of extended attributes for read only source files- new upstream bugfix release 7.6, removed applied patches, defuzzed the rest- fix double free error in fold for singlebyte locales (caused by multibyte patch)- fix sort -h for multibyte locales (reported via http://bugs.archlinux.org/task/16022)- fixed regression where df -l as regular user cause "Permission denied" (#520630, introduced by fix for rhbz #497830)- ls -i: print consistent inode numbers also for mount points (#453709)- Better fix than workaround the koji insufficient utimensat support issue to prevent failures in other packages- New upstream release 7.5, remove already applied patches, defuzz few others, xz in default set(by dependencies), so no explicit br required - skip two new tests on system with insufficient utimensat support(e.g. koji) - libstdbuf.so in separate coreutils-libs subpackage - update /etc/DIRCOLORS*- do process install-info only with info files present(#515970) - BuildRequires for xz, use xz tarball- ls -1U with two or more arguments (or with -R or -s) works properly again - install runs faster again with SELinux enabled (#479502)- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- do not ignore sort's version sort for multibyte locales (#509688)- temporarily workaround probable kernel issue with TCSADRAIN(#504798)- new upstream release 7.4, removed applied patches- fix segfaults in join (i18n patch) when using multibyte locales(#497368)- make mv xattr support failures silent (as is done for cp -a) - #496142- New upstream bugfix release 7.2 - removed applied patches - temporarily disable strverscmp failing gnulib test- do not ship /etc/DIR_COLORS.xterm - as many terminals use TERM xterm and black background as default - making ls color output unreadable - shipping /etc/DIR_COLORS.lightbgcolor instead of it for light(white/gray) backgrounds - try to preserve xattrs in cp -a when possible- fix sort bugs (including #485715) for multibyte locales as well- fix infinite loop in recursive cp (upstream, introduced by 7.1)- fix showing ACL's for ls -Z (#487374), fix automatic column width for it as well- fix couple of bugs (including #485715) in sort with determining end of fields(upstream)- workaround libcap issue with broken headers (#483548) - fix gnulib testsuite failure (4x77 (skip) is not 77(skip) ;) )- New upstream release 7.1 (temporarily using tar.gz tarball as there are no xz utils in Fedora), removed applied patches, amended patches and LS_COLORS files- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- added BuildRequires for libattr-devel and attr- cp/mv: add --no-clobber (-n) option to not overwrite target - cp/mv: add xattr support (#202823)- fix info documentation for expr command as well(#474434)- fixed syntax error w/ "expr" command using negative string/integer as first (i.e expr -125) - due to complexity of changes used diff against upstream git-head (#474434) - enable total-awk test again (and skip it when df not working)- package summary tuning- added requirements for util-linux-ng >= 2.14 because of file conflict in update from F-8/F-9(#472445) - some sed cleanup, df totaltests patch changes (not working correctly yet :( )- new upstream release - modification/removal of related patches - use automake 1.10.1 instead of 1.10a - temporarily skip df --total tests (failures), timeout-paramaters (failure on ppc64)- Requires: ncurses (#469277)- make possible to disable capability in ls due to performance impact when not cached(#467508) - do not patch generated manpages - generate them at build time - do not mistakenly display -g and -G runuser option in sx@SXlW Bu$ouurRRR R RRRRR R RRR R RRRRR R RRR?(Yu$ƨ=T8[E{2&~c6+; O4i!\qA3`4U6k7ܖ?C-Phї[V/tZ]oJ+[ afY&E'pႨ r# GM|\T{<Zo_FeG=Ey =B9P|ش #`$gZ6ӷ5-JaᛥX X 4z4 W[c!ڥsYM-I+%caGt{)Vv^UD4>a?O)1 u tcdGn ^3Ej8sWt|K;䀭PC..(nS]L?d2hLyxXqPxd %wJǽ L*wL!Li`섽 (6LCYB8a]h#7  EOYu$ƨB%1[Gpz==g.^qeOWݵ[sQ:=0MMZJsx0a$iD.>Ͳ[o7&ex54bbOj CtaVkZT [~\E;vhq }zkkޱZ9CWkZqV ܆.eŧ)9Nf(˷/o.|fc3Tz HO9c^e30b4021ebd850481b706cb7c897b6ba6ccb9994b b b5ff645c843673cb1f8225e52ea23b2d64eeedf0430c48323c56d7111efe31d855cedb3031d5361eacf3a47741e021ce95c18adba5881d899b70e738022952bb351965dd14b2c9ecdb520c7921882321e9275bff309d1512c33e6c2d000c97a8963898255043774eb77d14aed3a1584545c1c1a42b491b3847e2a374c2c4c76f9e2c4aa83756c3ed5cecc87352a43b49f746980f11183de084144480f389f009a62786e4130b9c8aca191d18e2831c4e8a747be112bcf422b3bb6f94f47a3d9c83b7fd613e116fef9cb4a1c9ebd6211f427df2e903904cf1cc3eeeafbf7a740a9d49ecb3b45995b0f7443217610ac5a260252b59ff525fd9d9b9f4fc03ca944a03fa307cd368e6d3d1364055394c1507975f867199e4c165a8ba9737728fc24052a934e98c27a568a8330014bccc45514bea851d174e08e1c0e02968cc1cd6a1b53476c6742d5a0614fe10bf0547195953ca1d37953e98f6e403e25ae167c62c1616f82ea455b5dbb90adc1df6e515844db018be617a7dddf1b641a6f91f644956c618117aef405bed08630bb9ce1b7067bf7f1229411f548ce9615e277b9b60177f675244b69d14741bda46863f4b148a023589ed43a82ffba026663127e99cf3889b9574a7f2a121cf16af94f655c6942d9398a010ae6dac66d4d6bf7a4ce1bed795f68470ff6bc472e6817f73732ef2732cb5f07a3fe1f09a5248cfad953ad7a4620381a66e7cd548a8a1d189bf00719c888a9a4ab7f66eeefbbcfc2f9c8d4f7d7117f1ca059be36fffcad3d144bba02bfebd3ac0a2bda73571f4d022c27d4b8d84b3b3644349cbdf71bdbd1ea130e3619447e8e525fafcae07df1ea3a972dddca702c03567a335239c79b43c76990e8e22334334066e741438b19678a450d817096a4377c9da6ba9cbea69429a48e80f9477df3096120e8eb7a8700f3b210c927dbe0a8bbd10519f86d0488bad2c8773186655d2236a51f17651adc641c63034a471d27c2416fa7b9c63f8e4ba82110ee531fabb3a14877fcc81c5863e29ea5e9a3a1f8d67c41e08271987a293bf9b9ab8155f1e353dde78309079221aebcccedb9f281f4ef489733350d8b671cd4810ccc2981272984cae5e48d2910029c55ee6e6801bff06cbd6d5c8c60f47dd9f39e85d6eceeb4bdda0a4518f8a12af73ab3fef80cff22cd036f90a464aaac63afa854aea526ce7a50546d71167d60ae75c302b60525a8eb0e1719e983e1c5c515c6c91d77afbac96dceda8de4ee454627e7b39dbddb17c27ea01ffed6045e8a1b19ba82fd5f0ad7887dc49ff12c0e1c097e5afba587c125e7c4ac90a8797adf1d5673c332bd8b170820ac1830876ece470d54efa4658ff2c51fed265812eb220a4b18a6952f742335546658545d148fe6d845c143a2ae511ae39a805b707bf7f151acea976a1069c4baa1df55020d78c40a0d230931050f6da8dd177eb7682ece49afb4b50564db31b0653425e5762b58c201e1cc9d39c3ffbd818d30e68e7d72bda02c65260d554d7f27eff955adf84f6e0204bbf2017ad6c0f9b2836de0a8374b4055e2dd6ce87f49846af3e4d0741c59ded0c7ccd379e8dda23efaf155143caea6e58a39c77aa692f1fe2302d28713b59a2a2a56f1c188fe9aa0488aa704ff57dda22136a5b9a1c5c6dcb8bf76d69e0f0e723b66b6c47f87793c713198d16181091ced28a7d45163b1abec315738839e39e15bf473f9d6c70848beb36fbae4511e304bc9496a54a972df91a01cfafba5a054dbce9609399d4b7bfa777095965ff8ffc7bd9247cd6995457c6c7240bf0270111e3b7ca6898a3f7fab184448e44b65c6dbd0f369e4c21c5aa84128e1ff2b0ea968xBX5Wصeu$ueufuD~,?yd  N $AV\dt |   X \l8(89|:)>u@uGuHuIvXv Yv\v<]vL^vbvdwewfwlwtwuwvwwyxyyy(yyy{ { }~~~ g~$h~(Cboost-date-time1.53.028.el7Run-Time component of boost date-time library Run-Time support for Boost Date Time, set of date-time libraries based on generic programming concepts.^ex86-01.bsys.centos.org!CentOSBoost and MIT and PythonCentOS BuildSystem System Environment/Librarieshttp://www.boost.orglinuxx86_64@@:A큤^^^PFR3d7d21d84775ee401b40efa6bcc81f225455ebe6cc10da75a2265b0b2fb290f781017f65bd9b5b121e5510bdc5132402d16856cf83fb346d0e15d76dff17be05c9bff75738922193e67fa726fa225535870d2aa1059f91452c411736284ad566rootrootrootrootrootrootrootrootboost-1.53.0-28.el7.src.rpmboost-date-timeboost-date-time(x86-64)libboost_date_time-mt.so.1.53.0()(64bit)libboost_date_time.so.1.53.0()(64bit)@@@@@@@@@@@@@   @ /sbin/ldconfig/sbin/ldconfiglibc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libm.so.6()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)librt.so.1()(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libstdc++.so.6(GLIBCXX_3.4)(64bit)libstdc++.so.6(GLIBCXX_3.4.15)(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)3.0.4-14.6.0-14.0-15.2-14.11.3\d[FX+WZWUeU@Tq@T @T=@S0SSz@SR@RURkRL RNQQ*@Q)@Q7/Q5@Q-@Q@QQQ@P@P,P+@P"TP!@P1@P@O OF@O"O!OOOOLOO@On@O3O?@O?@ON@Nǚ@N@NiN\N.@N)f@N@M@MM@M|MtMfH@MQ0@MOMJM*M%M!@Ls@LL@L@LoLi(@L[@LT@LN@LN@LI@LH2LLLGK@K]K@KqKhKf@KbK]KUKTM@KO@KLd@K,@K*@K(K>K>K>JJս@JJG@J#Ji@JL@J@J@J{J{J{IIyIIk0IKIG@I!\H@HH)HQH>G@G:G-@GG@GNF@FF@F@F$@FF@FFE@Ee@E[@EYEX^@D@DiCi@C@CC @CC@Cx|@CK@C B@B@B:B8AA@A@AQi@@@@@4@@b@@ia@@,@@'v@@@?]?\o@>@>@>Jonathan Wakely - 1.53.0-28Jonathan Wakely - 1.53.0-28Jonathan Wakely - 1.53.0-27Jonathan Wakely - 1.53.0-26Jonathan Wakely - 1.53.0-26Jonathan Wakely - 1.53.0-25Petr Machata - 1.53.0-24Petr Machata - 1.53.0-23Petr Machata - 1.53.0-22Petr Machata - 1.53.0-21Petr Machata - 1.53.0-20Petr Machata - 1.53.0-18Petr Machata - 1.53.0-15Brendan Conoboy - 1.53.0-16.1Daniel Mach - 1.53.0-16Daniel Mach - 1.53.0-15Petr Machata - 1.53.0-14x02X+X?$ </usr/share/licenses/php72-php-pecl-ssh2-1.4.1//var/opt/remi/php72/lib/pear/pkgxml/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuif [ -x /opt/remi/php72/root/usr/bin/pecl ] ; then /opt/remi/php72/root/usr/bin/pecl install --nodeps --soft --force --register-only --nobuild /var/opt/remi/php72/lib/pear/pkgxml/php72-php-pecl-ssh2.xml >/dev/null || : fi/bin/shhttps://forum.remirepo.net/?0hA]Ơ]!LΈJ]NoGVeɸ NoGVU4 +R100b16ab340b480477a3f81b1e9b74267caffa14g vg upport with autosuspend (David Arcari) [1464196] - [rtc] interface: Validate alarm-time before handling rollover (Steve Best) [1458401] - [rtc] interface: fix infinite loop in initializing the alarm (Steve Best) [1458401] - [rtc] opal: Handle disabled TPO in opal_get_tpo_time() (Steve Best) [1458401] - [hid] plantronics: Update to map volume up/down controls (Torez Smith) [1245271] - [hid] plantronics: remove superfluous .probe() (Torez Smith) [1245271] - [hid] plantronics: fix errant mouse events (Torez Smith) [1245271] - [misc] mei: make sysfs modalias format similar as uevent modalias (Pratyush Anand) [1451599] - [netdrv] e1000e: Add Support for 38.4MHZ frequency (David Arcari) [1475413] - [netdrv] e1000e: Add Support for CannonLake (David Arcari) [1475413] - [netdrv] e1000e: Initial Support for CannonLake (David Arcari) [1475413] - [netdrv] bonding: commit link status change after propose (Jarod Wilson) [1469987 1469790] - [netdrv] bonding: avoid NETDEV_CHANGEMTU event when unregistering slave (Jarod Wilson) [1470603]- [x86] platform/uv/bau: Disable BAU on single hub configurations (Frank Ramsay) [1473353 1472455] - [x86] platform/uv/bau: Fix congested_response_us not taking effect (Frank Ramsay) [1472455] - [x86] mce: Look in genpool instead of mcelog for pending error records (Oleksandr Natalenko) [1468257] - [x86] Avoid using object after free in genpool (Oleksandr Natalenko) [1468257] - [x86] kvm: svm: suppress unnecessary NMI singlestep on GIF=0 and nested exit (Ladi Prosek) [1440025] - [x86] kvm: svm: don't NMI singlestep over event injection (Ladi Prosek) [1440025] - [x86] kvm: svm: hide TF/RF flags used by NMI singlestep (Ladi Prosek) [1440025] - [x86] kvm: nsvm: do not forward NMI window singlestep VM exits to L1 (Ladi Prosek) [1440025] - [x86] kvm: svm: introduce disable_nmi_singlestep helper (Ladi Prosek) [1440025] - [x86] intel-family.h: Add GEMINI_LAKE SOC (Steve Best) [1461882] - [tools] perf machine: Fix segfault for kernel.kptr_restrict=2 (Jiri Olsa) [1464682] - [tools] perf symbols: Accept symbols starting at address 0 (Jiri Olsa) [1464682] - [powerpc] perf: Add per-event excludes on Power8 (Jiri Olsa) [1458868] - [powerpc] perf: Pass the struct perf_events down to compute_mmcr() (Jiri Olsa) [1458868] - [powerpc] fadump: provide a helpful error message (Pingfan Liu) [1438695] - [powerpc] fadump: avoid holes in boot memory area when fadump is registered (Pingfan Liu) [1438695] - [powerpc] fadump: avoid duplicates in crash memory ranges (Pingfan Liu) [1438695] - [powerpc] fadump: Update fadump documentation (Pingfan Liu) [1438695] - [powerpc] fadump: Reserve memory at an offset closer to bottom of RAM (Pingfan Liu) [1438695] - [powerpc] Fix dedotify for binutils >= 2.26 (Gustavo Duarte) [1464009] - [powerpc] Simplify module TOC handling (Gustavo Duarte) [1464009]- [mm] rmap: use pte lock not mmap_sem to set PageMlocked (Andrea Arcangeli) [1450367] - [mm] rmap: cleanup ttu_flags (Andrea Arcangeli) [1450367] - [mm] rmap: don't call mmu_notifier_invalidate_page() during munlock (Andrea Arcangeli) [1450367] - [mm] thp: respect MPOL_PREFERRED policy with non-local node (Larry Woodman) [1476709] - [mm] page-writeback.c: fix divide by zero in bdi_dirty_limits() (Jerome Mx!XW$oabhai Bernhard Rosenkraenzer Bernhard Rosenkraenzer Matt Wilson Cristian Gafton Michael Johnson Cristian Gafton Cristian Gafton Prospector System Cristian Gafton Cristian Gafton Donnie Barnes Erik Troan - Fix CVE-2017-12652 - Resolves: #1744870- Security fix for CVE-2015-8126 - Changing png_ptr to info_ptr base on upstream - Related: #1283575- Security fix for CVE-2015-8126 - Resolves: #1283575- Adding patch CVE-2013-6954 - Resolves: #1056863- Mass rebuild 2014-01-24- Mass rebuild 2013-12-27- Rebuilt for https://fedoraproject.org/wiki/Fedora_19_Mass_Rebuild- Update to libpng 1.5.13 for minor bug fixes- Update to libpng 1.5.12 for minor bug fixes - Activate chunk size limits by default, with a very generous default limit- Remove compat subpackage (it's now a separate package "libpng12") - Minor specfile cleanup per suggestions from Tom Callaway Related: #845110- Rebuilt for https://fedoraproject.org/wiki/Fedora_18_Mass_Rebuild- Update to libpng 1.5.10 and 1.2.49, for minor security issues (CVE-2011-3048) Resolves: #809597- Update to libpng 1.5.9 and 1.2.48, for minor security issues (CVE-2011-3045) Resolves: #801667- Fix CVE-2011-3026 Resolves: #791183- Update to libpng 1.5.8, for minor security issue (CVE-2011-3464)- Rebuilt for https://fedoraproject.org/wiki/Fedora_17_Mass_Rebuild- Update to libpng 1.5.7, for assorted minor fixes- Don't include libpng12.pc in the compat subpackage; instead just offer a phony Provides: for it in the devel subpackage- Update to new major release series 1.5.x; includes source-code-incompatible API changes and a soname version bump - Temporarily package 1.2.46 shared library (only) in libpng-compat subpackage so that dependent packages won't be broken while rebuilding proceeds- Update to libpng 1.2.46, includes fixes for CVE-2011-2501, CVE-2011-2690, CVE-2011-2691, CVE-2011-2692 Resolves: #717509 Resolves: #721307- Rebuilt for https://fedoraproject.org/wiki/Fedora_15_Mass_Rebuild- Use xz compressed source tarball Resolves: #647282- Update to libpng 1.2.44, includes fixes for CVE-2010-1205 and CVE-2010-2249 Resolves: #609161- Update to libpng 1.2.43, includes fix for CVE-2010-0205 Related: #566234- Update to libpng 1.2.42- Update to libpng 1.2.39- Rebuilt for https://fedoraproject.org/wiki/Fedora_12_Mass_Rebuild- Update to libpng 1.2.37, to fix CVE-2009-2042 Related: #504782- Update to libpng 1.2.35, to fix CVE-2009-0040- Rebuilt for https://fedoraproject.org/wiki/Fedora_11_Mass_Rebuild- Update to libpng 1.2.34- rebuild to get provides pkgconfig(libpng)- Update to libpng 1.2.33- Apply upstream patch for zTXT buffer overrun (CVE-2008-3964) Related: #461599- Update to libpng 1.2.31- Update to libpng 1.2.29 (fixes low-priority security issue CVE-2008-1382) Related: #441839- Update to libpng 1.2.24- Update to libpng 1.2.22, primarily to fix CVE-2007-5269 Related: #324771- Update License tag - Rebuild to fix Fedora toolchain issues- Add patch to fix CVE-2007-2445 Related: #239542- Update to libpng 1.2.16 Resolves: #211705, #216706, #227334 - Separate libpng.a into a -static subpackage - Other minor packaging fixes per Fedora merge review Resolves: #226038- Require pkgconfig in the -devel subpackage as it gets called by /usr/bin/libpng-config- Disable asm on arches other than i386 (#196580)- rebuild- Fix some paths in the -config script- fix multilib conflicts- Add a comment about the need to keep static libraries- Re-add static libraries- Update to 1.2.10 - Drop static libraries- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuilt- Rebuild with gcc4- Update to 1.2.8- Update to 1.2.7- Update to 1.2.6 - Combine patches- Build for FC3- Include LICENSE.- Build for FC2- Replace the patches for individual security prx X\Wx$o~mi@fedoraproject.org> 7.0.0-0.4.20150331git463ca30Remi Collet 7.0.0-0.3.20150325git2fe6acdRemi Collet 7.0.0-0.2.20150325git23336d7Remi Collet 7.0.0-0.1.20150325git23336d7Remi Collet 5.6.7-1Remi Collet 5.6.7-0.1.RC1Remi Collet 5.6.6-1Remi Collet 5.6.5-1Remi Collet 5.6.5-0.2.RC1Remi Collet 5.6.5-0.1.RC1Remi Collet 5.6.4-2Remi Collet 5.6.4-1Remi Collet 5.6.4-0.1.RC1Remi Collet 5.6.3-3Remi Collet 5.6.3-2Remi Collet 5.6.3-1Remi Collet 5.6.3-0.1.RC1Remi Collet 5.6.2-1Remi Collet 5.6.1-1Remi Collet 5.6.0-1.1Remi Collet 5.6.0-1Remi Collet - 5.6.0-0.1.RC4Remi Collet - 5.5.6-10Remi Collet - 5.5.6-9Remi Collet - 5.5.6-8Remi Collet - 5.5.6-7Remi Collet - 5.5.6-6Remi Collet - 5.5.6-5Remi Collet - 5.5.6-4Remi Collet 5.5.6-2Remi Collet 5.5.6-0Remi Collet 5.5.5-1Remi Collet 5.5.4-1Remi Collet 5.5.3-1Remi Collet 5.5.1-1Remi Collet 5.4.16-6Remi Collet 5.4.16-5Remi Collet 5.4.16-4Remi Collet - 5.4.16-3Remi Collet 5.4.16-2Remi Collet 5.4.16-1Remi Collet 5.4.14-3Remi Collet 5.4.14-2Remi Collet 5.4.14-1Remi Collet 5.4.13-1Remi Collet 5.4.11-1Remi Collet 5.4.10-1Remi Collet 5.4.9-1Remi Collet 5.4.8-7Remi Collet 5.4.8-6Remi Collet 5.4.8-5Remi Collet 5.4.8-6Remi Collet 5.4.8-4Remi Collet 5.4.8-4Remi Collet 5.4.8-3Joe Orton - 5.4.8-2Remi Collet 5.4.8-3Remi Collet 5.4.8-2.1Remi Collet 5.4.8-2Remi Collet 5.4.8-1.2Remi Collet 5.4.8-1Remi Collet 5.4.7-4Remi Collet 5.4.7-3Remi Collet 5.4.7-2Remi Collet 5.4.7-1Remi Collet 5.4.7-10Remi Collet 5.4.7-9Remi Collet 5.4.7-8Remi Collet 5.4.7-7Remi Collet 5.4.7-6Remi Collet 5.4.7-5Remi Collet 5.4.7-4Remi Collet 5.4.7-3Remi Collet 5.4.7-2Remi Collet 5.4.7-1Remi Collet 5.4.6-2Remi Collet 5.4.6-1Remi Collet 5.4.5-1Remi Collet 5.4.4-4Remi Collet 5.4.4-3Remi Collet 5.4.4-2Remi Collet 5.4.4-1Remi Collet 5.4.3-1Remi Collet 5.4.2-1Remi Collet 5.4.1-1Joe Orton - 5.4.0-6Remi Collet 5.4.0-5Joe Orton - 5.4.0-4Joe Orton - 5.4.0-3Joe Orton - 5.4.0-2Remi Collet 5.4.0-1Remi Collet 5.4.0-0.4.RC8Remi CxXWY)$9)*(xception_uncaught_error on 8.1- update to 11.0.1 (Jan 12, 2022)- update to 11.0.0 (Oct 22, 2021)- update to 10.4.5 (Nov 24, 2020)- update to 10.4.4 (Oct 2, 2020)- update to 10.4.3 (Sep 7, 2020)- update to 10.4.2 (Sep 1, 2020)- add aarch64 support- update to 10.4.1 (Jul 13, 2020)- update to 10.4.0 (Jun 29, 2020)- update to 10.4.0-beta2 for PHP 7.4 (Feb 28, 2020)- update to 10.4.0-beta1 for PHP 7.4 (Feb 27, 2020)- update to 10.3.9 (Oct 11, 2019)- update to 10.3.8 (Aug 23, 2019)- update to 10.3.7 (Jun 25, 2019)- update to 10.3.6 (Jun 18, 2019)- update to 10.3.5 (Jun 4, 2019)- update to 10.3.4 (Apr 7, 2019)- update to 10.3.2 (Jan 2, 2019)- update to 10.3.1 (Dec 28, 2018)- update to 10.3.0 (Dec 21, 2018)- update to 10.3.0-beta for PHP 7.3- update to 10.2.7 (Nov 8, 2018)- update to 10.2.5 (Sep 28, 2018)- update to 10.2.4 (Jul 27, 2018)- update to 10.2.3 (Jul 18, 2018)- update to 10.2.2 (Jun 22, 2018)- update to 10.2.1 (May 3, 2018)- update to 10.2.0 (Mar 7, 2018)- update to 10.1.1 (Jan 17, 2018)- add armv7hl as a target- update to 10.1.0 (Dec 14, 2017)- update to 10.0.4 (Nov 1, 2017)- update to 10.0.3 (Sep 26, 2017) - add new options in default configuration- update to 10.0.2 (Sep 11, 2017)- update to 10.0.1 (Aug 31, 2017)- add F27 workaround to https://bugzilla.redhat.com/1484370- update to 10.0.0 (Aug 2, 2017)- update to 6.1.0 (May 23, 2017)- update to 6.0.9 (Jan 26, 2017)- update to 6.0.8 (Dec 15, 2016)- update to 6.0.7 (Dec 4, 2016)- update to 6.0.6 (Oct 26, 2016)- update to 6.0.5 (Oct 7, 2016)- update to 6.0.4 (Sep 23, 2016)- update to 6.0.3 (Sep 19, 2016)- update to 6.0.1 (Sep 14, 2016)- update to 5.1.2 (Mar 22, 2016)- update to 5.1.1 (Feb 7, 2016)- update to 5.1.0 (Feb 5, 2016) - add new options in configuration file - remove README.txt, add USER-GUIDE.pdf - add missing LICENSE file from previous version- update to 5.0.23 (Jan 26, 2016) - re-add ZTS module on EL-5- update to 5.0.22 (Jan 20, 2016)- update to 5.0.21 (Jan 19, 2016)- update to 5.0.20 (Jan 16, 2016) - update configuration comments, remove sec.alert_action add slt, sec.block_stdin, update_domains_retry_interval - drop broken ZTS module on EL-5 http://forum.ioncube.com/viewtopic.php?p=10779- update to 5.0.19 (Oct 19, 2015)- update to 5.0.18 (Sep 14, 2015)- update to 5.0.17 (Sep 9, 2015)- update to 5.0.16 (Aug 27, 2015)- update to 5.0.15 (Aug 19, 2015)- update to 5.0.14 (Jul 29, 2015)- update to 5.0.13 (Jul 28, 2015)- update to 5.0.12 (Jul 13, 2015)- update to 5.0.11 (Jun 28, 2015)- update to 5.0.10 (Jun 22, 2015)- update to 5.0.9 (Jun 19, 2015)- update to 5.0.8 (Jun 16, 2015) - update configuration with new options- update to 5.0.7 (May 22, 2015)- update to 5.0.6 (May 18, 2015)- update to 5.0.5 (May 15, 2015)- update to 5.0.4 (May 8, 2015)- update to 5.0.3 (May 4, 2015)- update to 5.0.1 (Apr 27, 2015)- LICENSE.txt and README.txt are back http://forum.ioncube.com/viewtopic.php?t=4245 - php 5.5+ don't need full extension path- update to 4.7.5 (Feb 27, 2015)- update to 4.7.4 (Feb 10, 2015)- Fedora 21 SCL mass rebuild- update to 4.7.3 (Dec 15, 2014)- update to 4.7.2 (Nov 24, 2014)- update to 4.7.1 (Oct 31, 2014)- update to 4.6.2 (Oct 17, 2014) with PHP 5.6 support- update to 4.6.2 (Oct 14, 2014)- allow SCL build - make ZTS optional- update to 4.6.1 (Apr 22, 2014)- update to 4.6.0 (Apr 4, 2014)- update to 4.5.3 (Feb 11, 2014)- update to 4.5.2- update to 4.5.1- update to 4.4.4 (php 5.4 only)- update to 4.4.3 (php 5.4 only)- update to 4.4.1- initial package13.0.4-1.el7.remi13.0.4-1.el7.remi13.0.4-1.el7.remi01-ioncube_loader.iniioncube_loader.sophp56-php-ioncube-loader-13.0.4USER-GUIDE.txtphp56-php-ioncube-loader-13.0.4LICENSE.txt/opt/remi/php56/root/etc/php.d//opt/remi/php56/root/usr/lib64/php/modules//opt/remi/php56/root/usr/share/doc//opt/remi/php56/root/usr/share/doc/php56-php-ioncube-loader-13.0.4//opt/remi/php56/root/usr/share/licexX4X$)(64bit)libc.so.6(GLIBC_2.11)(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.17)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3)(64bit)libc.so.6(GLIBC_2.3.2)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libc.so.6(GLIBC_2.7)(64bit)libdl.so.2()(64bit)libdl.so.2(GLIBC_2.2.5)(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libm.so.6()(64bit)libm.so.6(GLIBC_2.2.5)(64bit)libncurses.so.5()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libpthread.so.0(GLIBC_2.3.2)(64bit)librt.so.1()(64bit)librt.so.1(GLIBC_2.2.5)(64bit)libstdc++.so.6()(64bit)libstdc++.so.6(CXXABI_1.3)(64bit)libstdc++.so.6(GLIBCXX_3.4)(64bit)libstdc++.so.6(GLIBCXX_3.4.11)(64bit)libstdc++.so.6(GLIBCXX_3.4.15)(64bit)libstdc++.so.6(GLIBCXX_3.4.9)(64bit)libtinfo.so.5()(64bit)mysql-community-libs(x86-64)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)5.7.93.0.4-14.6.0-14.0-15.2-14.11.3]pZhu@ZV@ZYeY(W@W{@W)@VV^VTQ@VD@V$@Vf@V }@U@U\w@Tи@T@T@SSS.S @SSXSB@S9XS L@Sc@RR@Rj]@Rj]@R^REs@R6R' RRR@R q@QQMQY@QQ@Qֵ@QQQP@Puc@PnP@P@OON@N @Np@NoENoENh@N\N\NNP@NEN-ZN(NMRMF@LLΫLdLbLk@L@K@KK[K@KK@KuBKKK2@K>J1@J@JJu@JJ@J:I-I@I@HH@G@G@Gs@F8}@FF@E{@EE=EE>>l~@>H>5@=2@<{;@:@:Q9%@77O7{X@6F6@A5Bjorn Munch - 5.7.28-1Balasubramanian Kandasamy - 5.7.23-1Bjorn Munch - 5.7.22-1Bharathy Satish - 5.7.21-1Bjorn Munch - 5.7.21-1Harin Vadodaria - 5.7.19-1Balasubramanian Kandasamy - 5.7.16-1Balasubramanian Kandasamy - 5.7.14-1Georgi Kodinov - 5.7.13-1Balasubramanian Kandasamy - 5.7.12-1Balasubramanian Kandasamy - 5.7.11-1Bjorn Munch - 5.7.10-1Bjorn Munch - 5.7.10-1Bharathy Satish - 5.7.10-1Tor Didriksen Balasubramanian Kandasamy - 5.7.9-1Balasubramanian Kandasamy - 5.7.8-0.2.rcBalasubramanian Kandasamy - 5.7.8-0.2.rcBalasubramanian Kandasamy - 5.7.6-0.2.m16Balasubramanian Kandasamy - 5.7.6-0.2.m16Bjorn Munch - 5.7.6-0.1.m16Erlend Dahl - 5.7.5-0.6.m15Balasubramanian Kandasamy - 5.7.5-0.5.m15Balasubramanian Kandasamy - 5.7.5-0.4.m15Balasubramanian Kandasamy - 5.7.5-0.3.m15Balasubramanian Kandasamy - 5.7.5-0.2.m15Balasubramanian Kandasamy - 5.7.5-0.1.m15Balasubramanian Kandasamy - 5.7.4-0.5.m14Balasubramanian Kandasamy - 5.7.4-0.4.m14Balasubramanian Kandasamy - 5.7.4-0.3.m14Balasubramanian Kandasamy - 5.7.4-0.2.m14Balasubramanian Kandasamy - 5.7.4-0.1.m14Balasubramanian Kandasamy - 5.7.3-0.3xxXWh{Z$JZ[Yb1cd7951249e4b71809a9f5d6726ea83d50778dfd54e7b9978ad2238179946994a0f716388c7d6bc1029b4494c751cd990fe4ce0f8c843a61a86ab089d73cafb7ca80391e1480626d8f9426141eeb3ccd435cc500ff30cbdb538927d027f5126bc2ca81e86ef5511e22484eeb63caf86e9aa596219dcc014485c1bee482b323de4b92f2786925f2945526088bea79434d4412bcc7f5bc1780b8f52006e4638ac0a8c40f379077d4b5227cfe27ddfb488d5074dc4886bcef9f6ab93dfa1e5d5c9af94ac498bbbcfa9598eae6fa54ad937ec32c1b29c8644b90ed0f38c20652a923d661737cef82bdc742ea8e85b6bc783d373c30c112d737216cc1d2ee630ad08ef024789b4f26038534a027f4c097bf2985e10e5ae4a8af380a65f2ac3a5ceb665d0fdd27ac9d0cc4abba667bc97fc8f2404b3f4fea76d838df83afaf14f2c719975287eb8d4a593251222c75e868dd55008ca8fed3961b0d752bc57b3f4076e32f0052d3f144c3c7eeeeef65f59b1026bc6c01c27a34d905374deb219638015a37b054ba6c915836dabf3c87af6d7cb45664f671f13b0402b88f156657a4b32b350addf8bb80e5a49533cfb113cdb6df230f9d650022e145611bf881b667efd4e60ad0e378f24aefbf1298edafac3c901fb1c92a37f11608430ecb8f7391806fb53a4d0e3bb221d3b8e1b97cce96fffe7d7891b4851c0e86e4304b6e53bae2e39dfa18b14fbd0a083662b1708552173c4fa6de2123408f7fcb07bfef1a67d1a582a372b8a8d18c1a44632ee81db6218aea70807e3f7ce440a6b821436ad4348ccaac39921db79cd1bd4e6c234a0e7ff77fd761e1e20fa48d7222b6d3706d50af02549321c8a72dd631a87845ab4fef2e4407ea1427e0ed75cc5b5edb3e916daabe2a975f90216cdb68dbe62ddc8b4a93b11734729f4ab2331c9256f1149fc088c55d6f349960b0685baed2c5f2862576edcc1bb44ca1ef15353452dd5486eb44f974f0173f10504b3054edfce527cf3b50f3722db50474a2d53bce98c697f9878c276bcef04f47344cc5c57b5334bd7f074413c6db3298789913a9a800b1d9891f909977ec1e20e8d360da59fe6f30f5d7997217b7dd7846bae6c85d4ff44a42048d8e2971a4da72ce20417a06419966b50f90cb0f4ce769b9ea18ab28b1a61c2f54d0d0f4d7913ab016825fceafd93a6f7df9550cdfefdd5b8c85edd92694d893fc5684448dfc2dc9a255f2de0d041ab8c785070d1e97ec4f080a714c433ce71ce2a5bf382fd21edfd9f8fc9dc276f0f1095513c6cd5bdf5e8cbd515501a2bb491b27e4d9144112eaa4d7f25d705e8dfa8bf1c6a6a10d114c6664ecb7c7c85da1f0b6f0ccfa017bcf91aeed5277f74350f4d32ad5ba92567092926806426b19aed35e28eb32ad50932e6b6fa67b510215ee98acbc4902c61e9aeb8249c4477cd28aaca926be06941cce185ba1684df21dcc2d515bb810bc0a35e332febb8dda26c50580226ccde7e71ca3d9f66e05977cd6634711244f9b1ec57e717fc08cc52995d7b28e362bad33893ba7a59c8b3ce276b55c1317d02ae6602d66e869521f9d1af7d0a1f6b17ff97356c34e4f9e178f100e9d6b9b79e29f730570bb38524a3d4be735996a8f6bdc36ec932ffed44ea19720d760081292d9b2c7758631692003f1441f5adbae64a3b11c90e38575249155244315fd6df73e5e4171d29258be3e11ca89350709ebf8435ef0b6a4db5d6fe0fcce16f1ce366f600175c7cbf263402e0aa4c0e0fea9986d577f32e57f61a1d7877c3eac04b880b04cc8c286db36a9cf04f3fc425f142af69bb015637815b56aa4bd9216a51ddd80c0105c198155f721363c9eda192320c9e9116192696f211cc50e7b6a72abbedaa3cbd4afb4b4c9be5c176d59390271d555b3f422ad4f9b7950ce1c087ea78ae6baa2b374b2241b9c66a0e817f01ae99061982bfa92d0db22d6d34b8a09f488e96830fbc70ff6f5ab4a129a31ddb26765bc672d82e93026225ec7f76593b543868880aef3b8e2ef1f31d4bac829a3198c351b3d2013652bc337ec273b0ccd9b90fd75754e40ef1da01b25fb942839e9a9879549fa53a0b6f7ecfeb4207b69058eb4ea6e7aa160ce50c9c7c3681805b9db850bb2ee4563e806cb05c413d08b8e1a2ffc9f27d310d3e65d9274741c359430795f2010b15e1dd155da1e8e71969b5348a7fa3b112fec661ae318cfa34c66d8478b8555de4864fa6cd6f308a4224eed82bcce07bce9ea2f611ff033448980cc33df2d0d75e38e95ef5c644ac2fbd4c945bce819d51ce78dfdf3493910c1f065814872bfd1dcb7cdfa40f25c161fed4d9f15d703c6b7038ef03349b869d4d413f69a760d4fbb8d8509105f60b96066d459d59dc80a986905a9214b4821738fe9abf18d03c81bdad2a385f7e7ec2a3d320bf7518e155c0eccb56d104fe318f3c105829281af473eddc122c12bcddf54a788e43c64caa20ed364b2d12e35d8a0c567875b9517976002acfda30bd26ff1977fd76e86d46a92f44c6a6026fd381844cec9aa74b60524442f1020b05ac273c12c9a293876831c46880f240b42da78e1d67a11aadf6fb81856cd8112a9afb9becace6dcd1b23248b14b3f291b854504ed73a21b03231be614ccb2f7cdacfe5fee333712782ddd3ca960a2c77be260e5b10e88a941f099b8662f732c616dc242a1b0c677a17e47691c23a625a084e2e4b3481cc2a94b37589513ffd10514d31b9452855e3ecf26ab7238aafb2612345d76666507bc48d7174c4f8c6c0630dbbcf34929ad6ca7a7f6aae1ae05a4865740ac9fec6630d98465c48xXWm`EFc$VFcEcGcobal symbol abuse (#216125)- rebuild against uw-imap-devel- update to 5.2.2 - synch changes from upstream recommended php.ini- enable SASL support in LDAP extension (#205772)- drop mime_magic extension (deprecated by php-pecl-Fileinfo)- fix regression in str_{i,}replace (from upstream)- update to 5.2.1 - add Requires(pre) for httpd - trim %changelog to versions >= 5.0.0- bump default memory_limit to 32M (#220821) - mark config files noreplace again (#174251) - drop trailing dots from Summary fields - use standard BuildRoot - drop libtool15 patch (#226294)- add php(api), php(zend-abi) provides (#221302) - package /usr/share/php and append to default include_path (#225434)- fix filter.h installation path - fix php-zend-abi version (Remi Collet, #212804)- rebuild again- rebuild for net-snmp soname bump- build json and zip shared, in -common (Remi Collet, #215966) - obsolete php-json and php-pecl-zip - build readline extension into /usr/bin/php* (#210585) - change module subpackages to require php-common not php (#177821)- provide php-zend-abi (#212804) - add /etc/rpm/macros.php exporting interface versions - synch with upstream recommended php.ini- update to 5.2.0 (#213837) - php-xml provides php-domxml (#215656) - fix php-pdo-abi provide (#214281)- rebuild for curl soname bump - add build fix for curl 7.16 API- from upstream: add safety checks against integer overflow in _ecalloc- update to 5.1.6 (security fixes) - bump default memory_limit to 16M (#196802)- rebuild- Provide php-posix (#194583) - only provide php-pcntl from -cli subpackage - add missing defattr's (thanks to Matthias Saou)- move Obsoletes for php-openssl to -common (#194501) - Provide: php-cgi from -cli subpackage- split out php-cli, php-common subpackages (#177821) - add php-pdo-abi version export (#193202)- rebuilt for new libnetsnmp- provide mod_php (#187891) - provide php-cli (#192196) - use correct LDAP fix (#181518) - define _GNU_SOURCE in php_config.h and leave it defined - drop (circular) dependency on php-pear- update to 5.1.4- update to 5.1.3- provide php-api (#183227) - add provides for all builtin modules (Tim Jackson, #173804) - own %{_libdir}/php/pear for PEAR packages (per #176733) - add obsoletes to allow upgrade from FE4 PDO packages (#181863)- bump again for double-long bug on ppc(64)- rebuilt for new gcc4.1 snapshot and glibc changes- rebuild for new libc-client soname- only build xmlreader and xmlwriter shared (#177810)- update to 5.1.2- rebuild again- rebuild for new net-snmp- enable short_open_tag in default php.ini again (#175381)- rebuilt- require net-snmp for php-snmp (#174800)- add /usr/share/pear back to hard-coded include_path (#174885)- rebuild for httpd 2.2- update to 5.1.1 - remove pear subpackage - enable pdo extensions (php-pdo subpackage) - remove non-standard conditional module builds - enable xmlreader extension- rebuilt against new openssl- pear: update to XML_RPC 1.4.4, XML_Parser 1.2.7, Mail 1.1.9 (#172528)- rebuild for new libnetsnmp- update to 5.0.5 - add fix for upstream #34435 - devel: require autoconf, automake (#159283) - pear: update to HTTP-1.3.6, Mail-1.1.8, Net_SMTP-1.2.7, XML_RPC-1.4.1 - fix imagettftext et al (upstream, #161001)- ldap: restore ldap_start_tls() function- disable RPATHs in shared extensions (#156974)- build simplexml_import_dom even with shared dom (#156434) - prevent truncation of copied files to ~2Mb (#155916) - install /usr/bin/php from CLI build alongside CGI - enable sysvmsg extension (#142988)- prevent build of builtin dba as well as shared extension- split out dba and bcmath extensions into subpackages - BuildRequire gcc-c++ to avoid AC_PROG_CXX{,CPP} failure (#155221) - pear: update to DB-1.7.6 - enable FastCGI support in /usr/bin/php-cgi (#149596)- build /usr/bin/php with the CLI SAPI, and add /usr/bin/php-cgi, built with the CGI SAPI (thanks to Edward Rudd, #137704) - add php(1) man page for CLI - fix more test cases to use -n when invoking php- rebuild for new libpq soname- bundle from PEAR: HTTP, Mail, xhX.- Update to boost-1.33.0, update SONAME to 2 due to ABI changes. - Simplified PYTHON_VERSION by Philipp Thomas - (#153093: boost warns that gcc 4.0.0 is an unknown compiler) - (#152205: development .so symbolic links should be in -devel subpackage) - (#154783: linker .so symbolic links missing from boost-devel package)- Revert boost-base.patch to old behavior. - Use SONAMEVERSION instead of dllversion.- (#142612: Compiling Boost 1.32.0 Failed in RHEL 3.0 on Itanium2) - (#150069: libboost_python.so is missing) - (#141617: bad patch boost-base.patch) - (#122817: libboost_*.so symbolic links missing) - Re-add boost-thread.patch. - Change boost-base.patch to show thread tags. - Change boost-gcc-tools.patch to use SOTAG, compile with dllversion. - Add symbolic links to files. - Sanity check can compile with gcc-3.3.x, gcc-3.4.2, gcc-4.0.x., gcc-4.1.x.- (#122817: libboost_*.so symbolic links missing) - (#141574: half of the package is missing) - (#141617: bad patch boost-base.patch)- Remove bogus Obsoletes.- Update to 1.32.0- cleanup specfile - fix multiarch problem- rebuilt- missing Obsoletes boost-python- (#121630: gcc34 patch needed)- #121415 FC2 BLOCKER: Obsoletes boost-python-devel, boost-doc - other cleanups- Remove bjam dependency. (via Graydon). - Fix installed library names. - Fix SONAMEs in shared libraries. - Fix installed header location. - Fix installed permissions.- rebuilt- Update to boost-1.31.0- Update to boost-1.31.0.rc2 - (#109307: Compile Failure with boost libraries) - (#104831: Compile errors in apps using Boost.Python...) - Unify into boost, boost-devel rpms. - Simplify installation using bjam and prefix install.- require boost-devel instead of devel in subpackages which require boost-devel - remove stray Prefix: tag- change license to Freely distributable - verify installation of libboost_thread - more boost-devel removals - deal with lack of _REENTRANT on ia64/s390 - (#99458) rpm -e fixed via explict dir additions - (#103293) update to 1.30.2- rebuilt- remove packager, change to new Group:- add deffattr's so we don't have unknown users owning files/sbin/ldconfig/sbin/ldconfig1.53.0-28.el71.53.0-28.el7libboost_date_time-mt.so.1.53.0libboost_date_time.so.1.53.0boost-date-time-1.53.0LICENSE_1_0.txt/usr/lib64//usr/share/doc//usr/share/doc/boost-date-time-1.53.0/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuELF 64-bit LSB shared object, x86-64, version 1 (GNU/Linux), dynamically linked, BuildID[sha1]=cbaf8ef4dda2d1ef88f015ac34d94b6c72f682e0, strippedELF 64-bit LSB shared object, x86-64, version 1 (GNU/Linux), dynamically linked, BuildID[sha1]=2df439409deec1511a4e0c90db7ab24a8e5c6f35, strippeddirectoryASCII text PRR RRRR R R R RRRRRPRRRRR R R RRRR?`P^`$ƨmpCf6kf pzgJdס]gܧ8 ?6AЎ"sUqſƢ ѩ{,qJ1j^}Vz 7\dt1O\y&VOog33(T5T.r툢nf"I?L%@n,mqtKٖ& ǎ כ|#zjkYPiyTuI( rMils6\Vߞ-B)eY͠ kqѫ:2)-----BEGIN PGP PUBLIC KEY BLOCK----- Version: rpm-4.11.3 (NSS-3) mQGiBEm+/6QRBAC5mbtqOFSQ0FkTLIMdIoqxtraIeUqwbPp3IBYQ/u/EREjyEf1D qFyBEXII0dD8JDT85vRZ81jhB7nFWa0VbUfY0xfghkbnokiNBVNpiQcvszw3UYDF aLAaOC8Z98vmlsQaBBTQG6704ZXLr7FJyG3GP5WE6egXIQQbrMcdmCoRBwCg/dwC HLWjuemoDc5SX7hKHbB4zZ8D/jP+oMbqz+bDn8OZ2UuaGdxr+mHW8tzTdPjnEU8e hUt1ws8eBqn/gMfKvUBa8xFSILe8Ty99u+VjFbcRsdf0H6dRre9AdDVUz5oxzoPw gamA8mhPQvFh3wt9smtRUh5IoM2LiM1s5pGMLuYuvSnVUPArEnSfW6K5I6v7OarU 3WfrBACDEGGcaWKjfdkRtmKIQrzu6AnldVC1ISLVAoqxHnKNFTk1BgO0PSZDpfJI x8fMCnGlusoL6F5+LYEk4K4B0zvlj1ur3JocjxpuBLccl94JTo/+I9ZbS8ptUqLw LBUkgIQJzzIH4G5NZsQ3FpzSWGRFVa7etqTv9BfUMUmJxhEoobQ/ZWxyZXBvLm9y ZyAoUlBNIFNpZ25pbmcgS2V5IGZvciBlbHJlcG8ub3JnKSA8c2VjdXJlQGVscmVw by5vcmc+iGAEExECACAFAkm+/6QCGwMGCwkIBwMCBBUCCAMEFgIDAQIeAQIXgAAK CRAwm8MFuq2uUlgWAKCGWOpyodbzxS7Xy/0X9m9qVnHq+ACfUHrQzYAtFRpT07Sg giosE+mvAKu5Ag0ESb7/pxAIALgT0q0HhwugE717a7N+gAtCbFu8pCXOZcrAnJpG cMA9VWmsODZStPTxXYM2ggCMSzUnNis8pPZOPIP5C+t2IYtVjLshM4C9UiY7u5ET jErWCxWmF+2QLO50K56E4qxj0wufZt9P+Ih0USUM5L2oyrQG51uj/2v3Qq3igc8Z NTtmEOfis3losusQbAfZtTBmNQ0570kkhMxiyavgAUxLenXHYrkDJFuL7XdBCmna kykTn2dzU81rIDZ+QPxII4V/eZ5xGiRY/EDUIAysEV2m0NNZgWi/twUnZICm7zYp VRviJrBnFTvNEPMhiGRnJgQp/Krv4WIHQ67N8lQg3q5RJX8AAwUH/0UBjBgbsuWR dB+ZYWjKPBy+bJY/6HefPUuLrt3QDNINMW8kY7VzWRMWyGc4IlPJDW0nwOn/vT5H Dgc3YmA3tm7cKj5wpFijzff61Db8eq+CUKGscKxDBGzHq6oirM5U7DQLmipCs5Eb efwHIjE3aOUSnoQmniEnBWI2hm/rftmY9oJSi8xgns4wAokDPiMcucADtbV3fznx ppuowtBi8bcGB1vJZjTySQcSKWv+IVp5ej06uZ9501BEm6HxUZkuAGPecP65kcQu 5bg7B7LQeI5AWyujqvfuWgAF34xhl9QU/sDWxM3wUog+bw7y8pyWCqnJhp70yx8o SqzhFygT62eISQQYEQIACQUCSb7/pwIbDAAKCRAwm8MFuq2uUq8PAKC1+E2pSwiS oHXkKYPYDwApsP1mVACfRe1YnggLYQtG9LMeweVQQC77rK8= =qyRr -----END PGP PUBLIC KEY BLOCK----- Ilocalhostpubkeyelrepo.org (RPM Signing Key for elrepo.org) Public Keys(none)gpg(elrepo.org (RPM Signing Key for elrepo.org) )gpg(baadae52)4.11.34:309bc305baadae52-49beffa44:309bc305baadae52-49beffa4?6c239af7e9e8885242xXXW0$*HN?Id   I '. Zr-'d' ' ' ' ' ,'''Np' |) ))(8191:$1>/ ?/@/G/$'H/'I0\'X0Y0\10']1'^4 b4d5Be5Gf5Jl5Lt5d'u6'v6wEh'xF'yFIIIL L N0N\N`'NgNhNCebtables2.0.1016.el7Ethernet Bridge frame table administration toolEthernet bridge tables is a firewalling tool to transparently filter network traffic passing a bridge. The filtering possibilities are limited to link layer filtering and some basic filtering on higher network layers. This tool is the userspace control for the bridge and ebtables kernel components. The ebtables tool can be used together with the other Linux filtering tools, like iptables. There are no known incompatibility issues.Zvx86-01.bsys.centos.orgZ+CentOSGPLv2+CentOS BuildSystem System Environment/Basehttp://ebtables.sourceforge.net/linuxx86_64 if [ $1 -eq 1 ] ; then # Initial installation systemctl preset ebtables.service >/dev/null 2>&1 || : fi /sbin/ldconfig if [ $1 -eq 0 ] ; then # Package removal, not upgrade systemctl --no-reload disable ebtables.service > /dev/null 2>&1 || : systemctl stop ebtables.service > /dev/null 2>&1 || : fi systemctl daemon-reload >/dev/null 2>&1 || : if [ $1 -ge 1 ] ; then # Package upgrade, not uninstall systemctl try-restart ebtables.service >/dev/null 2>&1 || : fi /sbin/ldconfig%nX8::)*9)*8*0@+))x8H:))hhhh+SFt/ЁA큤A큤ZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZvZ GZvZvNRgNRgZvZve140071e462df8aab9f7b63a3965bf206797ecbcff334a3ec494256defe35dcb521ad00696eca4d67ab660884f3cf7cca29f64915f8ae64f60f39d1e1ce5ff33e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b855e3b0c44298fc1c149afbf4c8996fb92427ae41e4649b934ca495991b7852b85588a59caf4f71ff347d6274c67020dbc7c762b41f2b1f5a65fcbd66f4ecbd6a07d80c98d068fbd4d7aab9685f97201d48c131ec5a06ee465278a736ab4a915dd526c6b009735e6218be3f38d0c510c3fac77ebfacfadc0963a637ea008f316cc9dc324b7ed6063e1484b7f0083adf223c11be89651837f6a00b0df4a463f894415c9c9cf21e1e47a819cb1ca21bbb1cd8eb8e7ece0c83e090c5a6fcdc5aa7fde3d1c5bcb7fb7a90c3016da51a3a578d5a70834ced4fb2cd32ef4fbdede5c52df0725684c9410f42d8c35585d8c605f3938efd49134d2fd6d29fb318cbc65f9139e780c6cfb3797b1a10bc0d15d4d57786cff9903b44b6c476ffeb43e97419a4ec90def8636a5f68ae9d29d2df714e717913eb52fe682bf2c6e6a5906ff6cae051da4c3fd59fcee2fcb64505dbaa496595137ecfd968bb43ee8a290a8b5a6d713bd143655f202e64f41057f7f3600fabc00a66a9837e71c84972361acbcc5ca4870ad6e1c98e495145b94394ed41f3040cfdb486f1f0f6ddab2ac3bd7bb50a49d9ac2299a5eeee0270495944b98d4fe6eb4596a5ccdff898fc51aa400585e73f0580f15b9ca0d7fa36227fc23f233fe323da38fb1f8b67ae1xЌXV@JeI$ueIfIC`h?[d$ ( G (,3: f~    d |4d303 3( 8 a9a:uaGW|HWIWXWYW\W]X^XbXdYdeYifYllYntYuYvYwZxZy[,[[[] ^  `$`P`T`\g``h`dCNetworkManager-tui1.18.82.el7_9NetworkManager curses-based UIThis adds a curses-based "TUI" (Text User Interface) to NetworkManager, to allow performing some of the operations supported by nm-connection-editor and nm-applet in a non-graphical environment._x86-02.bsys.centos.org CentOSGPLv2+CentOS BuildSystem System Environment/Basehttp://www.gnome.org/projects/NetworkManager/linuxx86_64 ________c3027f8c80dd53a14ea369042e1269a23961b97175252f16dad4b0cb4bee06267a8bc21ced6193059d648c310062ffcab19d89860a1eb9e03a69ae57bdc144287a8bc21ced6193059d648c310062ffcab19d89860a1eb9e03a69ae57bdc144287a8bc21ced6193059d648c310062ffcab19d89860a1eb9e03a69ae57bdc144287a8bc21ced6193059d648c310062ffcab19d89860a1eb9e03a69ae57bdc14428nmtuinmtuinmtuirootrootrootrootrootrootrootrootrootrootrootrootrootrootrootrootNetworkManager-1.18.8-2.el7_9.src.rpmNetworkManager-tuiNetworkManager-tui(x86-64)@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@    @ NetworkManagerNetworkManager-libnm(x86-64)ld-linux-x86-64.so.2()(64bit)ld-linux-x86-64.so.2(GLIBC_2.3)(64bit)libc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libdl.so.2()(64bit)libgcc_s.so.1()(64bit)libgcc_s.so.1(GCC_3.0)(64bit)libgcc_s.so.1(GCC_3.3.1)(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgmodule-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)libnewt.so.0.52()(64bit)libnewt.so.0.52(NEWT_0.52)(64bit)libnewt.so.0.52(NEWT_0.52.13)(64bit)libnewt.so.0.52(NEWT_0.52.6)(64bit)libnewt.so.0.52(NEWT_0.52.9)(64bit)libnm.so.0()(64bit)libnm.so.0(libnm_1_0_0)(64bit)libnm.so.0(libnm_1_10_0)(64bit)libnm.so.0(libnm_1_10_2)(64bit)libnm.so.0(libnm_1_12_0)(64bit)libnm.so.0(libnm_1_14_0)(64bit)libnm.so.0(libnm_1_16_0)(64bit)libnm.so.0(libnm_1_18_0)(64bit)libnm.so.0(libnm_1_2_0)(64bit)libnm.so.0(libnm_1_4_0)(64bit)libnm.so.0(libnm_1_6_0)(64bit)libnm.so.0(libnm_1_8_0)(64bit)libnspr4.so()(64bit)libnss3.so()(64bit)libnssutil3.so()(64bit)libplc4.so()(64bit)libplds4.so()(64bit)libpthread.so.0()(64bit)libpthread.so.0(GLIBC_2.2.5)(64bit)libsmime3.so()(64bit)libssl3.so()(64bit)libudev.so.1()(64bit)libuuid.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PartialHardlinkSets)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)1:1.18.8-2.el7_91:1.18.8-2.el7_93.0.4-14.6.0-14.0.4-14.0-15.2-14.11.3_ts@^@^@^^^^[]@]]B@]^@]\\!\[@\\\\@\@\[ͻ[@[h@[@[y[[<[8@[*A['[#@[ZZ Z|;ZtRZaxH|XX@,H-$nhp.net/releases/7_3_1.php- update to 7.3.1RC1 - oci8 version is now 2.2.0- update to 7.3.0 GA - update FPM configuration from upstream- update to 7.3.0RC6- update to 7.3.0RC5- test build for https://github.com/php/php-src/pull/3652- update to 7.3.0RC4- update to 7.3.0RC3- update to 7.3.0RC2 - use oracle client library version 18.3- update to 7.3.0RC1 - with oniguruma 6.9.0- add upstream patch for openssl failing test- add upstream patch for F29- update to 7.3.0beta3- update to 7.3.0beta2 - bump API numbers- update to 7.3.0alpha4- update to 7.3.0alpha3- update to 7.3.0alpha2 new sources- update to 7.3.0alpha2 - bump php(zend-abi) and php(api) to 20180606 - revert 5dd1ef90caec3021e6ce55c8554e695edf641eaf- update to 7.3.0alpha1 - switch from pcre to pcre2- update to 7.2.7RC1- Update to 7.2.6 - http://www.php.net/releases/7_2_6.php- rebuild against EL 7.5- update to 7.2.6RC1- Update to 7.2.5 - http://www.php.net/releases/7_2_5.php- update to 7.2.5RC1- add upstream patch for oniguruma 6.8.1, FTBFS #1562583- Update to 7.2.4 - http://www.php.net/releases/7_2_4.php - FPM: update default pool configuration for process.dumpable- add file trigger to restart the php-fpm service when new pool or new extension installed (F27+)- update to 7.2.4RC1- devel: drop dependency on devtoolset- Update to 7.2.3 - http://www.php.net/releases/7_2_3.php - FPM: revert pid file removal - improve devel dependencies- rebuild for new tag and drop patch merged upstream - drop ldconfig scriptlets on F28- update to 7.2.3RC1 - adapt systzdata, fixheader and ldap_r patches - apply upstream patch for date ext- Update to 7.2.2 - http://www.php.net/releases/7_2_2.php- update to 7.2.2RC1 - define SOURCE_DATE_EPOCH for reproducible build- Update to 7.2.1 - http://www.php.net/releases/7_2_1.php- add upstream patch for https://bugs.php.net/75579- update to 7.2.1RC1- update to 7.2.0 GA- update to 7.2.0RC6- update to 7.2.0RC5- enable argon2 password hash- update to 7.2.0RC4 - oci8 version is now 2.1.8- dont obsolete php72-php-pecl-libsodium- update to 7.2.0RC3- RC3 test build - F27: php now requires php-fpm and start it with httpd / nginx- update builder from RHEL 7.3 to RHEL 7.4- update to 7.2.0RC2- add patch for EL-6, fix undefined symbol: sqlite3_errstr- update to 7.2.0RC1- test build from git snapshot - refresh configuration files, sync with upstream, drop .so suffix- test build from git snapshot- test build from git snapshot - adapt tzdata patch for timelib 2017.05beta7 - disable httpd MPM check- update to 7.2.0beta3- add patch for EL-6, fix undefined symbol: sqlite3_errstr - revert use of sqlite3_close_v2 on EL-6- update to 7.2.0beta2 - oci8 version is now 2.1.7- update to 7.2.0beta1 - oci8 version is now 2.1.6 - bump apiver and zendver to 20170718- test build - add sodium extension in new sub-package- update to 7.2.0alpha3- update to 7.2.0alpha2 - oci8 version is now 2.1.5 - use oracle instant client version 12.2- update to 7.2.0alpha1- new snapshot - use system oniguruma (F26)- new snapshot- test build for release process test, 7.2.0alpha0 - dba: add --with-lmdb build option- new snapshot- new snapshot, May the 4th be with you - enable PHP execution of .phar files, see #1117140- refresh- update to 7.2.0-dev - drop mcrypt subpackage (removed upstream)- Update to 7.1.4 - http://www.php.net/releases/7_1_4.php- Update to 7.1.4RC1- Update to 7.1.3 - http://www.php.net/releases/7_1_3.php- fix interbase build on F26- Update to 7.1.3RC1- Update to 7.1.2 - http://www.php.net/releases/7_1_2.php- Update to 7.1.2RC1 (new sources)- Update to 7.1.2RC1- EL-7: add patch for https://bugs.php.net/73956 - switch back to gcc 6.2- EL-7: rebuild using gcc 4.8 instead of 6.2 because of https://bugzilla.redhat.com/1414348- Update to 7.1.1 - http://www.php.net/releases/7_1_1.php- Update to 7.1.1RC1- test optimized build using GCC 6.2- Update to 7.1.0 - http://www.php.net/releases/7_1_0.php - use bundled pcre library 8.38 on EL-7 - disable pcre.jit everywhere as it raise AVC xkXK`t $  4?   $ - 6 r  JV](XY ,h0mQINBGG4urcBEACrbsRa7tSSyxSfFkB+KXSbNM9rxYqoB78u107skReefq4/+Y72 TpDvlDZLmdv/lK0IpLa3bnvsM9IE1trNLrfi+JES62kaQ6hePPgn2RqxyIirt2se Si3Z3n3jlEg+mSdhAvW+b+hFnqxo+TY0U+RBwDi4oO0YzHefkYPSmNPdlxRPQBMv 4GPTNfxERx6XvVSPcL1+jQ4R2cQFBryNhidBFIkoCOszjWhm+WnbURsLheBp757l qEyrpCufz77zlq2gEi+wtPHItfqsx3rzxSRqatztMGYZpNUHNBJkr13npZtGW+kd N/xu980QLZxN+bZ88pNoOuzD6dKcpMJ0LkdUmTx5z9ewiFiFbUDzZ7PECOm2g3ve Jrwr79CXDLE1+39Hr8rDM2kDhSr9tAlPTnHVDcaYIGgSNIBcYfLmt91133klHQHB IdWCNVtWJjq5YcLQJ9TxG9GQzgABPrm6NDd1t9j7w1L7uwBvMB1wgpirRTPVfnUS Cd+025PEF+wTcBhfnzLtFj5xD7mNsmDmeHkF/sDfNOfAzTE1v2wq0ndYU60xbL6/ yl/Nipyr7WiQjCG0m3WfkjjVDTfs7/DXUqHFDOu4WMF9v+oqwpJXmAeGhQTWZC/Q hWtrjrNJAgwKpp263gDSdW70ekhRzsok1HJwX1SfxHJYCMFs2aH6ppzNsQARAQAB tDZNeVNRTCBSZWxlYXNlIEVuZ2luZWVyaW5nIDxteXNxbC1idWlsZEBvc3Mub3Jh Y2xlLmNvbT6JAlQEEwEIAD4WIQSFm+jXxYb1OEMLGcJGe5QtOnm9KQUCYbi6twIb AwUJA8JnAAULCQgHAgYVCgkICwIEFgIDAQIeAQIXgAAKCRBGe5QtOnm9KUewD/99 2sS31WLGoUQ6NoL7qOB4CErkqXtMzpJAKKg2jtBGG3rKE1/0VAg1D8AwEK4LcCO4 07wohnH0hNiUbeDck5x20pgS5SplQpuXX1K9vPzHeL/WNTb98S3H2Mzj4o9obED6 Ey52tTupttMF8pC9TJ93LxbJlCHIKKwCA1cXud3GycRN72eqSqZfJGdsaeWLmFmH f6oee27d8XLoNjbyAxna/4jdWoTqmp8oT3bgv/TBco23NzqUSVPi+7ljS1hHvcJu oJYqaztGrAEf/lWIGdfl/kLEh8IYx8OBNUojh9mzCDlwbs83CBqoUdlzLNDdwmzu 34Aw7xK14RAVinGFCpo/7EWoX6weyB/zqevUIIE89UABTeFoGih/hx2jdQV/NQNt hWTW0jH0hmPnajBVAJPYwAuO82rx2pnZCxDATMn0elOkTue3PCmzHBF/GT6c65aQ C4aojj0+Veh787QllQ9FrWbwnTz+4fNzU/MBZtyLZ4JnsiWUs9eJ2V1g/A+RiIKu 357Qgy1ytLqlgYiWfzHFlYjdtbPYKjDaScnvtY8VO2Rktm7XiV4zKFKiaWp+vuVY pR0/7Adgnlj5Jt9lQQGOr+Z2VYx8SvBcC+by3XAtYkRHtX5u4MLlVS3gcoWfDiWw CpvqdK21EsXjQJxRr3dbSn0HaVj4FJZX0QQ7WZm6WLkCDQRhuLq3ARAA6RYjqfC0 YcLGKvHhoBnsX29vy9Wn1y2JYpEnPUIB8X0VOyz5/ALv4Hqtl4THkH+mmMuhtndo q2BkCCk508jWBvKS1S+Bd2esB45BDDmIhuX3ozu9Xza4i1FsPnLkQ0uMZJv30ls2 pXFmskhYyzmo6aOmH2536LdtPSlXtywfNV1HEr69V/AHbrEzfoQkJ/qvPzELBOjf jwtDPDePiVgW9LhktzVzn/BjO7XlJxw4PGcxJG6VApsXmM3t2fPN9eIHDUq8ocbH dJ4en8/bJDXZd9ebQoILUuCg46hE3p6nTXfnPwSRnIRnsgCzeAz4rxDR4/Gv1Xpz v5wqpL21XQi3nvZKlcv7J1IRVdphK66De9GpVQVTqC102gqJUErdjGmxmyCA1OOO RqEPfKTrXz5YUGsWwpH+4xCuNQP0qmreRw3ghrH8potIr0iOVXFic5vJfBTgtcuE B6E6ulAN+3jqBGTaBML0jxgj3Z5VC5HKVbpg2DbB/wMrLwFHNAbzV5hj2Os5Zmva 0ySP1YHB26pAW8dwB38GBaQvfZq3ezM4cRAo/iJ/GsVE98dZEBO+Ml+0KYj+ZG+v yxzo20sweun7ZKT+9qZM90f6cQ3zqX6IfXZHHmQJBNv73mcZWNhDQOHs4wBoq+FG QWNqLU9xaZxdXw80r1viDAwOy13EUtcVbTkAEQEAAYkCPAQYAQgAJhYhBIWb6NfF hvU4QwsZwkZ7lC06eb0pBQJhuLq3AhsMBQkDwmcAAAoJEEZ7lC06eb0pSi8P/iy+ dNnxrtiENn9vkkA7AmZ8RsvPXYVeDCDSsL7UfhbS77r2L1qTa2aB3gAZUDIOXln5 1lSxMeeLtOequLMEV2Xi5km70rdtnja5SmWfc9fyExunXnsOhg6UG872At5CGEZU 0c2Nt/hlGtOR3xbt3O/Uwl+dErQPA4BUbW5K1T7OC6oPvtlKfF4bGZFloHgt2yE9 YSNWZsTPe6XJSapemHZLPOxJLnhs3VBirWE31QS0bRl5AzlO/fg7ia65vQGMOCOT LpgChTbcZHtozeFqva4IeEgE4xN+6r8WtgSYeGGDRmeMEVjPM9dzQObf+SvGd58u 2z9f2agPK1H32c69RLoA0mHRe7Wkv4izeJUc5tumUY0e8OjdenZZjT3hjLh6tM+m rp2oWnQIoed4LxUw1dhMOj0rYXv6laLGJ1FsW5eSke7ohBLcfBBTKnMCBohROHy2 E63Wggfsdn3UYzfqZ8cfbXetkXuLS/OM3MXbiNjg+ElYzjgWrkayu7yLakZx+mx6 sHPIJYm2hzkniMG29d5mGl7ZT9emP9b+CfqGUxoXJkjs0gnDl44bwGJ0dmIBu3aj VAaHODXyY/zdDMGjskfEYbNXCAY2FRZSE58tgTvPKD++Kd2KGplMU2EIFT7JYfKh HAB5DGMkx92HUMidsTSKHe+QnnnoFmu4gnmDU31i gpg-pubkey3a79bd2961b8bab7gpg(MySQL Release Engineering )-----BEGIN PGP PUBLIC KEY BLOCK----- Version: rpm-4.11.3 (NSS-3) mQINBGG4urcBEACrbsRa7tSSyxSfFkB+KXSbNM9rxYqoB78u107skReefq4/+Y72 TpDvlDZLmdv/lK0IpLa3bnvsM9IE1trNLrfi+JES62kaQ6hePPgn2RqxyIirt2se Si3Z3n3jlEg+mSdhAvW+b+hFnqxo+TY0U+RBwDi4oO0YzHefkYPSmNPdlxRPQBMv 4GPTNfxERx6XvVSPcL1+jQ4R2cQFBryNhidBFIkoCOszjWhm+WnbURsLheBp757l qEyrpCufz77zlq2gEi+wtPHItfqsx3rzxSRqatztMGYZpNUHNBJkr13npZtGW+kd N/xu980QLZxN+bZ88pNoOuzD6dKcpMJ0LkdUmTx5z9ewiFiFbUDzZ7PECOm2g3ve Jrwr79CXDLE1+39Hr8rDM2kDhSr9tAlPTnHVDcaYIGgSNIBcYfLmt91133klHQHB IdWCNVtWJjq5YcLQJ9Tx8[XW`9$b-2019-11047 - use oracle client library version 19.5 (18.5 on EL-6)- FPM: Fix CVE-2019-11043 env_path_info underflow in fpm_main.c- mbstring: Fix CVE-2019-13224 don't allow different encodings for onig_new_deluxe - pcre: Fix #75457 heap use-after-free in pcrelib- exif: Fix #78256 heap-buffer-overflow on exif_process_user_comment CVE-2019-11042 Fix #78222 heap-buffer-overflow on exif_scan_thumbnail CVE-2019-11041 - phar: Fix #77919 Potential UAF in Phar RSHUTDOWN- use oracle client library version 19.3 - disable opcache.huge_code_pages in default configuration- iconv: Fix #78069 Out-of-bounds read in iconv.c:_php_iconv_mime_decode() CVE-2019-11039 - exif: Fix #77988 Heap-buffer-overflow on php_jpg_get16 CVE-2019-11040 - sqlite3: Fix #77967 Bypassing open_basedir restrictions via file uris- exif: Fix #77950 Heap-buffer-overflow in _estrndup via exif_process_IFD_TAG CVE-2019-11036- exif: Fix #77753 Heap-buffer-overflow in php_ifd_get32s CVE-2019-11034 Fix #77831 Heap-buffer-overflow in exif_iif_add_value CVE-2019-11035 - sqlite3: Added sqlite3.defensive INI directive- Fix #76846 Segfault in shutdown function after memory limit error- Fix #77630 rename() across the device may allow unwanted access during processing CVE-2019-9637- exif: Fix #77509 Uninitialized read in exif_process_IFD_in_TIFF CVE-2019-9641 Fix #77540 Invalid Read on exif_process_SOFn CVE-2019-9640 Fix #77563 Uninitialized read in exif_process_IFD_in_MAKERNOTE CVE-2019-9638 Fix #77659 Uninitialized read in exif_process_IFD_in_MAKERNOTE CVE-2019-9639 - phar: Fix #77396 Null Pointer Dereference in phar_create_or_parse_filename Fix #77586 - phar_tar_writeheaders_int() buffer overflow - spl: Fix #77431 openFile() silently truncates after a null byte- core: Fix #77369 memcpy with negative length via crafted DNS response CVE-2019-9022 - mbstring: Fix #77370 buffer overflow on mb regex functions - fetch_token CVE-2019-9023 Fix #77371 heap buffer overflow in mb regex functions compile_string_node CVE-2019-9023 Fix #77381 heap buffer overflow in multibyte match_at CVE-2019-9023 Fix #77382 heap buffer overflow in expand_case_fold_string CVE-2019-9023 Fix #77385 buffer overflow in fetch_token CVE-2019-9023 Fix #77394 buffer overflow in multibyte case folding - unicode CVE-2019-9023 Fix #77418 heap overflow in utf32be_mbc_to_code CVE-2019-9023 - phar: Fix #77247 heap buffer overflow in phar_detect_phar_fname_ext CVE-2019-9021 - xmlrpc: Fix #77242 heap out of bounds read in xmlrpc_decode CVE-2019-9020 Fix #77380 global out of bounds read in xmlrpc base64 code CVE-2019-9024- Update to 7.0.33 - http://www.php.net/releases/7_0_33.php - use oracle client library version 18.3- Update to 7.0.32 - http://www.php.net/releases/7_0_32.php- Update to 7.0.31 - http://www.php.net/releases/7_0_31.php- Update to 7.0.30 - http://www.php.net/releases/7_0_30.php - use systemd RuntimeDirectory instead of /etc/tmpfiles.d- Update to 7.0.29 - http://www.php.net/releases/7_0_29.php - FPM: update default pool configuration for process.dumpable- Update to 7.0.28 - http://www.php.net/releases/7_0_28.php- Update to 7.0.27 - http://www.php.net/releases/7_0_27.php- Update to 7.0.27RC1- Update to 7.0.26 - http://www.php.net/releases/7_0_26.php- Update to 7.0.26RC1- Update to 7.0.25 - http://www.php.net/releases/7_0_25.php- Update to 7.0.25RC1 - oci8 version is now 2.1.8- Update to 7.0.24 - http://www.php.net/releases/7_0_24.php- update builder from RHEL 7.3 to RHEL 7.4- Update to 7.0.24RC1- add patch for EL-6, fix undefined symbol: sqlite3_errstr- Update to 7.0.23 - http://www.php.net/releases/7_0_23.php- Update to 7.0.23RC1 - oci8 version is now 2.1.7- add patch for EL-6, fix undefined symbol: sqlite3_errstr- Update to 7.0.22 - http://www.php.net/releases/7_0_22.php- Update to 7.0.22RC1 - oci8 version is now 2.1.6- Update to 7.0.21 - http://www.php.net/releases/7_0_21.php- Update to 7.0.21RC1 - oci8 version is now 2.1.5 - use oracle xJXW8_R$BRSQ2.8-14.el7_9.12.8-14.el7_9.120.0.14 freetype-configfreetype2freetypeconfigftconfig-64.hftconfig.hftheader.hftmodule.hftoption.hftstdlib.hfreetype.hftadvanc.hftautoh.hftbbox.hftbdf.hftbitmap.hftbzip2.hftcache.hftcffdrv.hftchapters.hftcid.hfterrdef.hfterrors.hftfntfmt.hftgasp.hftglyph.hftgxval.hftgzip.hftimage.hftincrem.hftlcdfil.hftlist.hftlzw.hftmac.hftmm.hftmodapi.hftmoderr.hftotval.hftoutln.hftpcfdrv.hftpfr.hftrender.hftsizes.hftsnames.hftstroke.hftsynth.hftsystem.hfttrigon.hftttdrv.hfttypes.hftwinfnt.ht1tables.httnameid.htttables.htttags.httunpat.hft2build.hlibfreetype.sofreetype2.pcfreetype2.m4freetype-devel-2.8CHANGESdesignbasic-design.pngdesign-1.htmldesign-2.htmldesign-3.htmldesign-4.htmldesign-5.htmldesign-6.htmldetailed-design.pngindex.htmllibrary-model.pngsimple-model.pngformats.txtft2faq.htmlglyphsbbox1.pngbbox2.pngbody_comparison.pngbravo_kerned.pngbravo_unkerned.pngclipping.pngdown_flow.pngglyphs-1.htmlglyphs-2.htmlglyphs-3.htmlglyphs-4.htmlglyphs-5.htmlglyphs-6.htmlglyphs-7.htmlgrid_1.pngindex.htmllayout.pnglayout2.pngmetrics.pngmetrics2.pngpoints_conic.pngpoints_conic2.pngpoints_cubic.pngpoints_segment.pngtwlewis1.pngtwlewis2.pngup_flow.pngreferenceREADMEft2-auto_hinter.htmlft2-base_interface.htmlft2-basic_types.htmlft2-bdf_fonts.htmlft2-bitmap_handling.htmlft2-bzip2.htmlft2-cache_subsystem.htmlft2-cff_driver.htmlft2-cid_fonts.htmlft2-computations.htmlft2-error_code_values.htmlft2-error_enumerations.htmlft2-font_formats.htmlft2-gasp_table.htmlft2-glyph_management.htmlft2-glyph_stroker.htmlft2-glyph_variants.htmlft2-gx_validation.htmlft2-gzip.htmlft2-header_file_macros.htmlft2-header_inclusion.htmlft2-incremental.htmlft2-index.htmlft2-lcd_filtering.htmlft2-list_processing.htmlft2-lzw.htmlft2-mac_specific.htmlft2-module_management.htmlft2-multiple_masters.htmlft2-ot_validation.htmlft2-outline_processing.htmlft2-pcf_driver.htmlft2-pfr_fonts.htmlft2-quick_advance.htmlft2-raster.htmlft2-sfnt_names.htmlft2-sizes_management.htmlft2-system_interface.htmlft2-toc.htmlft2-truetype_engine.htmlft2-truetype_tables.htmlft2-tt_driver.htmlft2-type1_tables.htmlft2-user_allocation.htmlft2-version.htmlft2-winfnt_fonts.htmltutorialexample1.cexample2.cppexample3.cppexample4.cppexample4.proexample5.cppexample5.svgindex.htmlmetrics.pngmetrics2.pngstep1.htmlstep2.htmlstep3.htmlfreetype-config.1.gz/usr/bin//usr/include//usr/include/freetype2//usr/include/freetype2/freetype//usr/include/freetype2/freetype/config//usr/lib64//usr/lib64/pkgconfig//usr/share/aclocal//usr/share/doc//usr/share/doc/freetype-devel-2.8//usr/share/doc/freetype-devel-2.8/design//usr/share/doc/freetype-devel-2.8/glyphs//usr/share/doc/freetype-devel-2.8/reference//usr/share/doc/freetype-devel-2.8/tutorial//usr/share/man/man1/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnux(:XW8Bv$"vvBp?d   3dh  & 4 P  +NhQ(|8*9,*: z*GHIXY\] ^Hbxdeflt4uPvlwxy  ,X\dghhlClua-devel5.1.415.el7Development files for luaThis package contains development files for lua.Xworker1.bsys.centos.orgjCentOSMITCentOS BuildSystem System Environment/Librarieshttp://www.lua.org/linuxx86_64-V ⁤XXXXXXXc741f9c1587f29fd08a79acbe0c46884768a47f89bee4147669f774c5cf50fc0c2a78484b53d115d9229a62e8d16db8309f1c68415b56ad5672e00674119bebbfd83f7e823cfbb03ac2da937ec83f01b4a6ddaac220a4fa1ffd6c6c3842c589043b38e4d2a423b162c49e130e72e1b0a1cb41010a58ce073419cd7e8464d111f13f880e9dd997a0f7fd0b17ccd949c98f33e95bd120f084de66084e8882174130d3fe76e62b61e2d1872bedebea91a9aec4ef7ae41b1b8378ec9217b25d6587aliblua-5.1.sorootrootrootrootrootrootrootrootrootrootrootrootrootrootlua-5.1.4-15.el7.src.rpmlua-devellua-devel(x86-64)pkgconfig(lua)@    /usr/bin/pkg-configluapkgconfigrpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(PayloadIsXz)5.1.4-15.el73.0.4-14.6.0-14.0-15.2-14.11.3VURURkQPOMUMQ0@MBMBKJjJ0I2H|@H(1@HGiGhGG GJ@G?@G?@F@EE2"E0@D@D@Dn@D~Dz@D_2D_2CR@Bt@BU B Ao@?@>HYaakov Selkowitz - 5.1.4-15Daniel Mach - 5.1.4-14Daniel Mach - 5.1.4-13Fedora Release Engineering - 5.1.4-12Fedora Release Engineering - 5.1.4-11Fedora Release Engineering - 5.1.4-10Tim Niemueller - 5.1.4-9Fedora Release Engineering - 5.1.4-8Tim Niemueller - 5.1.4-7Tim Niemueller - 5.1.4-6Tim Niemueller - 5.1.4-5Fedora Release Engineering - 5.1.4-4Tim Niemueller - 5.1.4-2Fedora Release Engineering - 5.1.4-2Tim Niemueller - 5.1.4-1Tim Niemueller - 5.1.3-6Tim Niemueller - 5.1.3-5Hans de Goede 5.1.3-4Tim Niemueller - 5.1.3-3Fedora Release Engineering - 5.1.3-2Hans de Goede 5.1.3-1Hans de Goede 5.1.2-4Hans de Goede 5.1.2-3Hans de Goede 5.1.2-2Hans de Goede 5.1.2-1Hans de Goede 5.1.1-3Hans de Goede 5.1.1-2Hans de Goede 5.1.1-1Michael J. Knox - 5.1-7Michael J. Knox - 5.1-6Michael J. Knox - 5.1-5Michael J. Knox - 5.1-4Michael J. Knox - 5.1-3x)XZWPZ$- 7.1.33-26Remi Collet - 7.1.33-25Remi Collet - 7.1.33-24Remi Collet - 7.1.33-23Remi Collet - 7.1.33-22Remi Collet - 7.1.33-20Remi Collet - 7.1.33-19Remi Collet - 7.1.33-18Remi Collet - 7.1.33-17Remi Collet - 7.1.33-16Remi Collet - 7.1.33-15Remi Collet - 7.1.33-14Remi Collet - 7.1.33-13Remi Collet - 7.1.33-12Remi Collet - 7.1.33-11Remi Collet - 7.1.33-10Remi Collet - 7.1.33-9Remi Collet - 7.1.33-8Remi Collet - 7.1.33-7Remi Collet - 7.1.33-6Remi Collet - 7.1.33-5Remi Collet - 7.1.33-4Remi Collet - 7.1.33-2Remi Collet - 7.1.33-1Remi Collet - 7.1.32-1Remi Collet - 7.1.31-1Remi Collet - 7.1.30-3Remi Collet - 7.1.30-1Remi Collet - 7.1.29-1Remi Collet - 7.1.28-1Remi Collet - 7.1.27-1Remi Collet - 7.1.26-2Remi Collet - 7.1.26-1Remi Collet - 7.1.25-2Remi Collet - 7.1.25-1Remi Collet - 7.1.25~RC1-1Remi Collet - 7.1.24-3Remi Collet - 7.1.24-1Remi Collet - 7.1.24~RC1-2Remi Collet - 7.1.24~RC1-1Remi Collet - 7.1.23-1Remi Collet - 7.1.23~RC1-1Remi Collet - 7.1.22-1Remi Collet - 7.1.22~RC1-1Remi Collet - 7.1.21-1Remi Collet - 7.1.20-1Remi Collet - 7.1.20~RC1-1Remi Collet - 7.1.19-1Remi Collet - 7.1.19~RC1-1Remi Collet - 7.1.18-1Remi Collet - 7.1.18~RC1-2Remi Collet - 7.1.18~RC1-1Remi Collet - 7.1.17-1Remi Collet - 7.1.16-1Remi Collet - 7.1.16~RC1-2Remi Collet - 7.1.16~RC1-1Remi Collet - 7.1.15-2Remi Collet - 7.1.15-1Remi Collet - 7.1.15~RC1-1Remi Collet - 7.1.14-1Remi Collet - 7.1.14~RC1-1Remi Collet - 7.1.13-1Remi Collet - 7.1.13~RC1-1Remi Collet - 7.1.12-2Remi Collet - 7.1.12-1Remi Collet - 7.1.12~RC1-1Remi Collet - 7.1.11-1Remi Collet - 7.1.11~RC1-1Remi Collet - 7.1.10-1Remi Collet - 7.1.10~RC1-3Remi Collet - 7.1.10~RC1-2Remi Collet - 7.1.10~RC1-1Remi Collet - 7.1.9-3Remi Collet - 7.1.9-2Remi Collet - 7.1.9-1Remi Collet - 7.1.9~RC1-2Remi Collet - 7.1.9~RC1-1Remi Collet - 7.1.8-2Remi Collet - 7.1.8-1Remi Collet - 7.1.8~RC1-1Remi Collet - 7.1.7-1Remi Collet - 7.1.7~RC1-1Remi Collet - 7.1.6-1Remi Collet - 7.1.6~RC1-1Remi Collet - 7.1.5-1Remi Collet - 7.1.5~RC1-2Remi Collet - 7.1.5~RC1-1Remi Collet - 7.1.4-1Remi Collet - 7.1.4-0.1.RC1Remi Collet - 7.1.3-1Remi Collet - 5.6.40-30Remi Collet - 5.6.40-29Remi Collet - 5.6.40-28Remi Collet - 5.6.40-27Remi Collet - 5.6.40-26Remi Collet - 5.6.40-25Remi Collet - 5.6.40-24Remi Collet - 5.6.40-23Remi Collet - 5.6.40-22Remi Collet - 5.6.40-21Remi Collet - 5.6.40-20Remi Collet - 5.6.40-19Remi Collet - 5.6.40-18.fc32Remi Collet - 5.6.40-18Remi Collet - 5.6.40-17Remi Collet - 5.6.40-15Remi Collet - 5.6.40-14Remi Collet - 5.6.40-13Remi Collet - 5.6.40-12Remi Collet - 5.6.40-11Remi Collet - 5.6.40-9Remi Collet - 5.6.40-8Remi Collet - 5.6.40-7Remi Collet - 5.6.40-6Remi Collet - 5.6.40-5Remi Collet - 5.6.40-4Remi Collet - 5.6.40-3Remi Collet - 5.6.40-2Remi Collet - 5.6.40-1Remi Collet - 5.6.39-1Remi Collet - 5.6.38-2Remi Collet - 5.6.38-1Remi Collet - 5.6.37-2Remi Collet - 5.6.37-1Remi Collet - 5.6.36-1Remi Collet - 5.6.35-1Remi Collet - 5.6.34-2Remi Collet - 5.6.34-1Remi Collet 5.6.33-1Remi Collet 5.6.32-1Remi Collet - 5.6.31-4Remi Collet - 5.6.31-3Remi Collet 5.6.31-2Remi Collet 5.6.31-1Remi Collet - 5.6.30-5Remi Collet - 5.6.30-4Remi Collet 5.6.30-3Remi Collet 5.6.30-1Remi Collet 5.6.30-0.1.RC1Remi Collet 5.6.29-1Remi Collet 5.6.29-0.1.RC1Remi Collet 5.6.28-1Remi Collet 5.6.28-0.1.RC1Remi Collet 5.6.27-1Remi Collet 5.6.27-0.1.RC1Remi Collet 5.6.26-1Remi Collet 5.6.26-0.1.RC1Remi Collet 5.6.25-1Remi Collet 5.6.25-0.1.RC1Remi Collet 5.6.24-1Remi Collet 5.6.24-0.1.RC1Remi Collet 5.6.23-1.1Remi Collet 5.6.23-1Remi Collet 5.6.23-0.1.RC1Remi Collet 5.6.22-1Remi Collet 5.6.22-0.1.RC1Remi Collet 5.6.21-1Remi Collet 5.6.21-0.1.RC1Remi Collet 5.6.20-1Remi Collet 5.6.20-0.1.RC1Remi Collet 5.6.19-2Remi Collet 5.6.19-1Remi Collet 5.6.19-0.1.RC1Remi Collet 5.6.18-1Remi Collet 5.6.18-0.2.RC1Remi Collet 5.6.18-0.1.RC1Remi Collet 5.6.17-1Remi Collet 5.6.17-0.1.RC1Remi Collet 5.6.16-1Remi Collet 5.6.16-0.1.RC1Remi Collet 5.6.15-1Remi Collet 5.6.15-0.1.RC1Remi Collet 5.6.14-1Remi Collet 5.6.14-0.1.RC1Remi Collet 5.6.13-1Remi Collet 5.6.12-1Remi Collet 5.6.12-0.1.RC1Remi Collet 5.6.11-1Remi Collet <xX)X $"G?ld ' H\`x|      _ h  w ()*+,-8191:1@ZDbGlHIXY\]^ybd?eDfGlIaCLP|_ _ Nx|ghCphp72-php-pecl-ssh21.4.11.el7.remiBindings for the libssh2 libraryBindings to the libssh2 library which provide access to resources (shell, remote exec, tunneling, file transfer) on a remote machine using a secure cryptographic transport. Documentation: http://php.net/ssh2 Package built for PHP 7.2 as Software Collection (php72 by remi).eɷbbuilder.remirepo.netRemi's RPM repository #StandWithUkrainePHP-3.01Remi ColletUnspecifiedhttps://pecl.php.net/package/ssh2linuxx86_64if [ $1 -eq 0 -a -x /opt/remi/php72/root/usr/bin/pecl ] ; then /opt/remi/php72/root/usr/bin/pecl uninstall --nodeps --ignore-errors --register-only ssh2 >/dev/null || : fi1Lh<@< +RA큤A큤eɷ`eɷaeɷaeƾeɷbeƾeɷ`6add54b4d2eacc69e1c431c4f621e7bfab270087981ef4f76c1ad221d209822c8a59181a36fd7789a613250bb0ae4b00d5cd0c637ee54f6ca73524b44c41932711d02753da80b2fff91d9b535c8c5955e19035bc7dc7b12b95bda5e1d9d95957ac7c56f1e416ce6e60abcf26269395128bc9e5a2e4f3293e5dcc124aac606508da04e887c16349c8f895f34d73ca02346d3b5145aa09323bd6e1ef0c5dc1864drootrootrootrootrootrootrootrootrootrootrootrootrootrootphp72-php-pecl-ssh2-1.4.1-1.el7.remi.src.rpmphp72-php-ssh2php72-php-ssh2(x86-64)php72-php-pecl(ssh2)php72-php-pecl(ssh2)(x86-64)php72-php-pecl-ssh2php72-php-pecl-ssh2(x86-64)      remi-libssh2(x86-64)php72-php(zend-abi)php72-php(api)/bin/sh/bin/sh/bin/shrpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rpmlib(CompressedFileNames)rpmlib(PayloadIsXz)1.1120170718-6420170718-644.6.0-14.0-13.0.4-15.2-14.11.3if [ -x /opt/remi/php72/root/usr/bin/pecl ] ; then /opt/remi/php72/root/usr/bin/pecl install --nodeps --soft --force --register-only --nobuild /var/opt/remi/php72/lib/pear/pkgxml/php72-php-pecl-ssh2.xml >/dev/null || : fi # posttrans as pear can be installed after usphp72-php-peare@d/@d!dP@dA)@bJ@a/k@`>(`>(_ts@_Z@^h]@]nU]6[ug@[O+[4Ym@Ym@YP@YJ_YA%@X@X$a@W;W]NV<@UJ@TTdS%@SO@R@PP@N@N@NJ[MMRKO@JjJlE@JY@I@IL@IH}Remi Collet - 1.4.1-1Remi Collet - 1.4-4Remi Collet - 1.4-3Remi Collet - 1.4-2Remi Collet - 1.4-1Remi Collet - 1.3.1-3Remi Collet - 1.3.1-2Remi Collet - 1.3.1-1Remi Collet - 1.3-1Remi Collet - 1.2-4Remi Collet - 1.2-3Remi Collet - 1.2-2Remi Collet - 1.2-1Remi Collet - 1.1.2-6Remi Collet - 1.1.2-5Remi Collet - 1.1.2-4Remi Collet - 1.1.2-3Remi Collet - x`XV`x$ys/7_1_3.php- fix interbase build on F26- Update to 7.1.3RC1- Update to 7.1.2 - http://www.php.net/releases/7_1_2.php- Update to 7.1.2RC1 (new sources)- Update to 7.1.2RC1- EL-7: add patch for https://bugs.php.net/73956 - switch back to gcc 6.2- EL-7: rebuild using gcc 4.8 instead of 6.2 because of https://bugzilla.redhat.com/1414348- Update to 7.1.1 - http://www.php.net/releases/7_1_1.php- Update to 7.1.1RC1- test optimized build using GCC 6.2- Update to 7.1.0 - http://www.php.net/releases/7_1_0.php - use bundled pcre library 8.38 on EL-7 - disable pcre.jit everywhere as it raise AVC #1398474 - sync provided configuration with upstream production defaults- Update to 7.1.0RC6- Update to 7.1.0RC5- Update to 7.1.0RC4 - update tzdata patch to v14, improve check for valid tz file - oci8 version is now 2.1.3- rebuild- Update to 7.1.0RC3- Update to 7.1.0RC2 - API version is now 20160303- Update to 7.1.0RC1 - oci8 version is now 2.1.2- Update to 7.1.0beta2- Update to 7.1.0beta1- Update to 7.1.0alpha3- own tests/doc directories for pecl packages (f24)- Update to 7.1.0alpha2 (rebuild)- Update to 7.1.0alpha2- Update to 7.1.0alpha1- Update to 7.0.7 - http://www.php.net/releases/7_0_7.php- Update to 7.0.7RC1 - oci8 version is now 2.1.1- Update to 7.0.6 - http://www.php.net/releases/7_0_6.php - rebuild for new sources- Update to 7.0.6 http://www.php.net/releases/7_0_6.php- Update to 7.0.6RC1- Fixed bug #71914 (Reference is lost in "switch")- Update to 7.0.5 http://www.php.net/releases/7_0_5.php- Update to 7.0.5RC1- adapt for F24: define %pecl_xmldir and own it- Update to 7.0.4 http://www.php.net/releases/7_0_4.php - pcre: disables JIT compilation of patterns with system pcre < 8.38- Update to 7.0.4RC1- Update to 7.0.3 http://www.php.net/releases/7_0_3.php- test build- FPM: test build for https://bugs.php.net/62172- Update to 7.0.3RC1- Update to 7.0.2 http://www.php.net/releases/7_0_2.php- Update to 7.0.2RC1 - opcache: build with --disable-huge-code-pages on EL-6- Update to 7.0.1 http://www.php.net/releases/7_0_1.php - curl: add CURL_SSLVERSION_TLSv1_x constant (EL) - fpm: switch to UDS on Fedora >= 21- Update to 7.0.1RC1 - drop --disable-huge-code-pages build option on EL-6, but keep it disabled in default configuration- build with --disable-huge-code-pages on EL-6- Update to 7.0.0 http://www.php.net/releases/7_0_0.php- set opcache.huge_code_pages=0 on EL-6 see https://bugs.php.net/70973 and https://bugs.php.net/70977- Update to 7.0.0RC8 - set opcache.huge_code_pages=1 on x86_64- Update to 7.0.0RC7 (retagged)- Update to 7.0.0RC7- Update to 7.0.0RC6- php-config: reports all built sapis- rebuild as retagged- Update to 7.0.0RC5 - update php-fpm.d/www.conf comments - API and Zend API are now set to 20151012- Update to 7.0.0RC4 - php-fpm: set http authorization headers- F23 rebuild with rh_layout- Update to 7.0.0RC3 - disable zip extension (provided in php-pecl-zip)- Update to 7.0.0RC2 - enable oci8 and pdo_oci extensions - sync php.ini with upstream php.ini-production- Update to 7.0.0RC1- Update to 7.0.0beta3- Update to 7.0.0beta2 - switch from libvpx to libwebp (only for bundled libgd, not used)- Update to 7.0.0beta1 - use upstream tarball instead of git snapshot- Update to 7.0.0alpha2 - use new layout (/etc/opt, /var/opt)- new snapshot- new snapshot - the phar link is now correctly created- Update to 7.0.0alpha1- new snapshot- new snapshot - t1lib support have been removed- new snapshot- new snapshot- new snapshot- add experimental file based opcode cache (disabled by default)- new snapshot- new snapshot - adapt system tzdata patch for upstream change for new zic- new snapshot- new snapshot- new snapshot- rename 10-php70-php.conf to 15-php70-php.conf to ensure load order (after 10-rh-php56-php.conf)- rebuild- fix mod_php configuration - disable static json - sync php.ini with upstream php.ini-production- update for php 7.0.0 - ereg, mssql, mysql and sybase_ct extensions are removed - add pdo-dblib subpackage xصXW+H$Qƒrywhere as it raise AVC #1398474 - sync provided configuration with upstream production defaults- Update to 7.1.0RC6- Update to 7.1.0RC5- Update to 7.1.0RC4 - update tzdata patch to v14, improve check for valid tz file - oci8 version is now 2.1.3- rebuild- Update to 7.1.0RC3- Update to 7.1.0RC2 - API version is now 20160303- Update to 7.1.0RC1 - oci8 version is now 2.1.2- Update to 7.1.0beta2- Update to 7.1.0beta1- Update to 7.1.0alpha3- own tests/doc directories for pecl packages (f24)- Update to 7.1.0alpha2 (rebuild)- Update to 7.1.0alpha2- Update to 7.1.0alpha1- Update to 7.0.7 - http://www.php.net/releases/7_0_7.php- Update to 7.0.7RC1 - oci8 version is now 2.1.1- Update to 7.0.6 - http://www.php.net/releases/7_0_6.php - rebuild for new sources- Update to 7.0.6 http://www.php.net/releases/7_0_6.php- Update to 7.0.6RC1- Fixed bug #71914 (Reference is lost in "switch")- Update to 7.0.5 http://www.php.net/releases/7_0_5.php- Update to 7.0.5RC1- adapt for F24: define %pecl_xmldir and own it- Update to 7.0.4 http://www.php.net/releases/7_0_4.php - pcre: disables JIT compilation of patterns with system pcre < 8.38- Update to 7.0.4RC1- Update to 7.0.3 http://www.php.net/releases/7_0_3.php- test build- FPM: test build for https://bugs.php.net/62172- Update to 7.0.3RC1- Update to 7.0.2 http://www.php.net/releases/7_0_2.php- Update to 7.0.2RC1 - opcache: build with --disable-huge-code-pages on EL-6- Update to 7.0.1 http://www.php.net/releases/7_0_1.php - curl: add CURL_SSLVERSION_TLSv1_x constant (EL) - fpm: switch to UDS on Fedora >= 21- Update to 7.0.1RC1 - drop --disable-huge-code-pages build option on EL-6, but keep it disabled in default configuration- build with --disable-huge-code-pages on EL-6- Update to 7.0.0 http://www.php.net/releases/7_0_0.php- set opcache.huge_code_pages=0 on EL-6 see https://bugs.php.net/70973 and https://bugs.php.net/70977- Update to 7.0.0RC8 - set opcache.huge_code_pages=1 on x86_64- Update to 7.0.0RC7 (retagged)- Update to 7.0.0RC7- Update to 7.0.0RC6- php-config: reports all built sapis- rebuild as retagged- Update to 7.0.0RC5 - update php-fpm.d/www.conf comments - API and Zend API are now set to 20151012- Update to 7.0.0RC4 - php-fpm: set http authorization headers- F23 rebuild with rh_layout- Update to 7.0.0RC3 - disable zip extension (provided in php-pecl-zip)- Update to 7.0.0RC2 - enable oci8 and pdo_oci extensions - sync php.ini with upstream php.ini-production- Update to 7.0.0RC1- Update to 7.0.0beta3- Update to 7.0.0beta2 - switch from libvpx to libwebp (only for bundled libgd, not used)- Update to 7.0.0beta1 - use upstream tarball instead of git snapshot- Update to 7.0.0alpha2 - use new layout (/etc/opt, /var/opt)- new snapshot- new snapshot - the phar link is now correctly created- Update to 7.0.0alpha1- new snapshot- new snapshot - t1lib support have been removed- new snapshot- new snapshot- new snapshot- add experimental file based opcode cache (disabled by default)- new snapshot- new snapshot - adapt system tzdata patch for upstream change for new zic- new snapshot- new snapshot- new snapshot- rename 10-php70-php.conf to 15-php70-php.conf to ensure load order (after 10-rh-php56-php.conf)- rebuild- fix mod_php configuration - disable static json - sync php.ini with upstream php.ini-production- update for php 7.0.0 - ereg, mssql, mysql and sybase_ct extensions are removed - add pdo-dblib subpackage (instead of php-mssql) - disable oci8 extension, not yet adapted for 7.0 - add php-zip subpackage - add php-json subpackage- Update to 5.6.7 http://www.php.net/releases/5_6_7.php- update to 5.6.7RC1- Update to 5.6.6 http://www.php.net/releases/5_6_6.php- Update to 5.6.5 http://www.php.net/releases/5_6_5.php- fix php-fpm.service.d location- update to 5.6.5RC1 - add base system path in default include path - FPM: enable ACL for Unix Domain Socket- Update to 5.6.4 http://www.php.net/releases/5_6_4.php - add sybase_ct extension (in mssql sub-package) - xmlrpc reqxPXjU$6te to 7.2.1 - http://www.php.net/releases/7_2_1.php- add upstream patch for https://bugs.php.net/75579- update to 7.2.1RC1- update to 7.2.0 GA- update to 7.2.0RC6- update to 7.2.0RC5- enable argon2 password hash- update to 7.2.0RC4 - oci8 version is now 2.1.8- dont obsolete php72-php-pecl-libsodium- update to 7.2.0RC3- RC3 test build - F27: php now requires php-fpm and start it with httpd / nginx- update builder from RHEL 7.3 to RHEL 7.4- update to 7.2.0RC2- add patch for EL-6, fix undefined symbol: sqlite3_errstr- update to 7.2.0RC1- test build from git snapshot - refresh configuration files, sync with upstream, drop .so suffix- test build from git snapshot- test build from git snapshot - adapt tzdata patch for timelib 2017.05beta7 - disable httpd MPM check- update to 7.2.0beta3- add patch for EL-6, fix undefined symbol: sqlite3_errstr - revert use of sqlite3_close_v2 on EL-6- update to 7.2.0beta2 - oci8 version is now 2.1.7- update to 7.2.0beta1 - oci8 version is now 2.1.6 - bump apiver and zendver to 20170718- test build - add sodium extension in new sub-package- update to 7.2.0alpha3- update to 7.2.0alpha2 - oci8 version is now 2.1.5 - use oracle instant client version 12.2- update to 7.2.0alpha1- new snapshot - use system oniguruma (F26)- new snapshot- test build for release process test, 7.2.0alpha0 - dba: add --with-lmdb build option- new snapshot- new snapshot, May the 4th be with you - enable PHP execution of .phar files, see #1117140- refresh- update to 7.2.0-dev - drop mcrypt subpackage (removed upstream)- Update to 7.1.4 - http://www.php.net/releases/7_1_4.php- Update to 7.1.4RC1- Update to 7.1.3 - http://www.php.net/releases/7_1_3.php- fix interbase build on F26- Update to 7.1.3RC1- Update to 7.1.2 - http://www.php.net/releases/7_1_2.php- Update to 7.1.2RC1 (new sources)- Update to 7.1.2RC1- EL-7: add patch for https://bugs.php.net/73956 - switch back to gcc 6.2- EL-7: rebuild using gcc 4.8 instead of 6.2 because of https://bugzilla.redhat.com/1414348- Update to 7.1.1 - http://www.php.net/releases/7_1_1.php- Update to 7.1.1RC1- test optimized build using GCC 6.2- Update to 7.1.0 - http://www.php.net/releases/7_1_0.php - use bundled pcre library 8.38 on EL-7 - disable pcre.jit everywhere as it raise AVC #1398474 - sync provided configuration with upstream production defaults- Update to 7.1.0RC6- Update to 7.1.0RC5- Update to 7.1.0RC4 - update tzdata patch to v14, improve check for valid tz file - oci8 version is now 2.1.3- rebuild- Update to 7.1.0RC3- Update to 7.1.0RC2 - API version is now 20160303- Update to 7.1.0RC1 - oci8 version is now 2.1.2- Update to 7.1.0beta2- Update to 7.1.0beta1- Update to 7.1.0alpha3- own tests/doc directories for pecl packages (f24)- Update to 7.1.0alpha2 (rebuild)- Update to 7.1.0alpha2- Update to 7.1.0alpha1- Update to 7.0.7 - http://www.php.net/releases/7_0_7.php- Update to 7.0.7RC1 - oci8 version is now 2.1.1- Update to 7.0.6 - http://www.php.net/releases/7_0_6.php - rebuild for new sources- Update to 7.0.6 http://www.php.net/releases/7_0_6.php- Update to 7.0.6RC1- Fixed bug #71914 (Reference is lost in "switch")- Update to 7.0.5 http://www.php.net/releases/7_0_5.php- Update to 7.0.5RC1- adapt for F24: define %pecl_xmldir and own it- Update to 7.0.4 http://www.php.net/releases/7_0_4.php - pcre: disables JIT compilation of patterns with system pcre < 8.38- Update to 7.0.4RC1- Update to 7.0.3 http://www.php.net/releases/7_0_3.php- test build- FPM: test build for https://bugs.php.net/62172- Update to 7.0.3RC1- Update to 7.0.2 http://www.php.net/releases/7_0_2.php- Update to 7.0.2RC1 - opcache: build with --disable-huge-code-pages on EL-6- Update to 7.0.1 http://www.php.net/releases/7_0_1.php - curl: add CURL_SSLVERSION_TLSv1_x constant (EL) - fpm: switch to UDS on Fedora >= 21- Update to 7.0.1RC1 - drop --disable-huge-code-pages build option on EL-6, but keep it disabled in default configuration- build with --disable-huge-code-pages on EL-6- Update to 7.0.0 xȔXWh$`php.net/releases/5_6_8.php- add upstream patch to drop SSLv3 tests- Update to 5.6.7 http://www.php.net/releases/5_6_7.php- rebuild for new tokyocabinet in EL-5- Update to 5.6.6 http://www.php.net/releases/5_6_6.php- Update to 5.6.5 http://www.php.net/releases/5_6_5.php- update to 5.6.5RC1 - FPM: enable ACL for Unix Domain Socket- Update to 5.6.4 http://www.php.net/releases/5_6_4.php - add sybase_ct extension (in mssql sub-package) - xmlrpc requires xml- Update to 5.6.4 http://www.php.net/releases/5_6_4.php- php 5.6.4RC1- FPM: add upstream patch for https://bugs.php.net/68421 access.format=R doesn't log ipv6 address - FPM: add upstream patch for https://bugs.php.net/68420 listen=9000 listens to ipv6 localhost instead of all addresses - FPM: add upstream patch for https://bugs.php.net/68423 will no longer load all pools- Update to PHP 5.6.3 http://php.net/releases/5_6_3.php - GMP: add upstream patch for https://bugs.php.net/68419 Fix build with libgmp < 4.2- php 5.6.3RC1 (refreshed, phpdbg changes reverted)- new version of systzdata patch, fix case sensitivity - ignore Factory in date tests- php 5.6.3RC1 (refreshed) - enable phpdbg_webhelper new extension (in php-dbg)- php 5.6.3RC1 - disable opcache.fast_shutdown in default config - disable phpdbg_webhelper new extension for now- Update to PHP 5.6.2 http://php.net/releases/5_6_2.php- Update to PHP 5.6.1 http://php.net/releases/5_6_1.php- test build for upcoming 5.6.1 - use default system cipher list by Fedora policy http://fedoraproject.org/wiki/Changes/CryptoPolicy- provides nginx configuration (see #1142298)- php 5.6.1RC1- ensure gd-last 2.1.0-3, with libvpx support, is used- enable libvpx on EL 6 (with libvpx 1.3.0)- PHP 5.6.0 is GA - fix ZTS man pages, upstream patch for 67878- backport rawhide stuff for F21+ and httpd-filesystem with support for SetHandler to proxy_fcgi- php 5.6.0RC4- php 5.6.0RC3 - fix license handling - fix zts-php-config --php-binary output #1124605 - cleanup with_libmysql - add php-litespeed subpackage (/usr/bin/lsphp)- dont display timezone version in phpinfo (tzdata patch v11)- test build for #67635- php 5.6.0RC2- add workaround for unserialize/mock issue from 5.4/5.5- fix phpdbg with libedit https://bugs.php.net/67499- php 5.6.0RC1- test build for serialize- test build for bug 67410, 67411, 67412, 67413 - fix 67392, dtrace breaks argument unpack- fix regression introduce in fix for #67118- php 5.6.0beta4- php 5.6.0beta3- new snapshot php5.6-201405061030- php 5.6.0beta2- php 5.6.0beta1- new snapshot php5.6-201404090430 - add numerical prefix to extension configuration files - prevent .user.ini files from being viewed by Web clients - load php directives only when mod_php is active- new snapshot php5.6-201403261230 - oci8 version 2.0.9 - opcache version 7.0.4-dev- new snapshot php5.6-201403170630- new snapshot php5.6-201403120830 - rebuild against gd-last without libvpx on EL < 7 - oci8 version 2.0.8- php 5.6.0alpha3 - add php-dbg subpackage - update php.ini from upstream production template - move /usr/bin/zts-php to php-cli subpackage- php-fpm should own /var/lib/php/session and wsdlcache- test build for https://bugs.php.net/66762- another test build of 5.5.10RC1 - fix memleak in fileinfo ext - revert test changes for pcre 8.34- test build of 5.5.10RC1- upstream patch for https://bugs.php.net/66731- Update to 5.5.9 http://www.php.net/ChangeLog-5.php#5.5.9 - Install macros to /usr/lib/rpm/macros.d where available. - Add configtest option to php-fpm ini script (EL)- test build of 5.5.9RC1- fix _httpd_mmn expansion in absence of httpd-devel- test build for https://bugs.php.net/66412- update to 5.5.8 - drop conflicts with other opcode caches as both can be used only for user data cache- another test build of 5.5.8RC1- test build of 5.5.8RC1- test build for https://bugs.php.net/66331- update to 5.5.7, fix for CVE-2013-6420 - fix zend_register_functions breaks reflection, php bug 66218 - fix Heap buffer over-read in DateInterval, php bx@XTW00ho$X-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -m64 -mtune=genericcpioxz2x86_64-redhat-linux     directoryELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=94b8d8d40b912e9e69bd8a3b1b1ed3460530ee61, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a70cbb8ce3ee2375d77e13bc94045013189aa30f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a4e6c064f20507cb360df102d416400ea0c535fd, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=5dd299045db2286fb8b547bbd72c26d78829c5f4, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=6b4b8e83792e1db135ab0509d2e6c9cfbf7c90f0, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e424ffa592f7cc58212f9f0b7fb7901e0ba30729, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a41038f22d1ecac11f2b88938cc70b2af0e18341, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=c3c00793a852f30717eaefe96b1b0b6a152814b6, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=8a90f5671ace689ce697fc88102f9752ccee8755, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=e63592168f8058d315284d60187069326913db2b, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=eeddf085a9cb17919edf8e8eee8efacadfc573f7, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f0903cf5709be1eea8163df9931a20c2f8361ec6, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=639acfcad10483416069b6ccf003e29b0498bf6f, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=f03bcb2709d15e34ed446f971f7385cb482674a5, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=9c52d681465251546a53c941ee03888fa8e50a4e, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=d44b8bf5f69b273a74ac7b4b0c08279fcac6cb03, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=59198094d77b9a54d1bcea865743b6096917c15e, strippedASCII text %1:COYdnw  2R R R RRRRRRRRR%R R RRRRRRR%R R RRRRRRR%R R R RRRR%RRR RR R R RRRRR%R R RRRRRRR%R R RRRRRRR%R R RRRRRRRRRR%R R RRRRRRRR%R R RRRRRRRRR%R R RRRRRRRR%R R RRRRRRR%RRRR R R RRRR%R R RRRRRRR%RRR RR R R RRRRR%PPRRRR R R RRRRRRR%PPPPP P P P P PPPPPPPPPPPPPPPPPR!RRRRR R RR R R RRRRRRRR RRRRR%?` xsX=X $  ۴ZB.ώb%{{6̎*$#aOQ43kSd6gRw+f28ؑ?G1![${jReW>}]z1d'Bozt'ջsO[2H\ L"u:Jo ;iFclJämcuns`A=_-T5BV!-}}'.4KLV|8A =:_*)8m#oN5/0}/.6cڏ 5sMI Χ]Qۗ|j\l?Wrc 蟓efiEk\PiS~)\ȿ!4y9AS6}n·0|"PO9!ņ8C F{-:y)b mysql-build@oss.oracle.com F{-:y)Xp#[l/NV<47ҵ_3D!ȻFgQ `kZz?֡)-!"g6P %ԎĽ\$fiaLr0% WkqO!o Ű'fTGD8ď Eyz.fX:c|%eF1[n5/jvË2YcC>Wչ:̨p/@cS77k:M m Ń1cE->:"6B2Eì Ex0B7.Kc7ajmey`Ļ5Akc%Tghoi1GP<.1!O 3|ҲiNRf=\OГJGS2!~Y!BD@>:^lfZGo`,u&[Z7V٣Suv $a'7 Yԝd|t]6 % 4eҺ˝ݫc bA14ElT`BtSOTb!]L/O'922f20c78499335f7e7e6f850cf0a98682fabe6f3bM<bhCdovecot-mysql2.2.368.el7MySQL back end for dovecotThis package provides the MySQL back end for dovecot-auth etc._tHx86-02.bsys.centos.org\xCentOSMIT and LGPLv2CentOS BuildSystem System Environment/Daemonshttp://www.dovecot.org/linuxx86_64\x_t_t_t31b0c35c53f84e20644b48804d88affb026970dbe75b5dc9d77ca40dc9dd2d66../libdriver_mysql.so../libdriver_mysql.sorootrootrootrootrootrootdovecot-2.2.36-8.el7.src.rpmdovecot-mysqldovecot-mysql(x86-64)libdriver_mysql.so()(64bit)@@@@@@@@@@@   @ dovecotlibc.so.6()(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.4)(64bit)libcrypto.so.10()(64bit)libdl.so.2()(64bit)libm.so.6()(64bit)libmysqlclient.so.18()(64bit)libmysqlclient.so.18(libmysqlclient_18)(64bit)libpthread.so.0()(64bit)libssl.so.10()(64bit)libz.so.1()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)1:2.2.36-8.el73.0.4-14.6.0-14.0-15.2-14.11.3_C_16^\@]g@]R@]R@[:@[^[XWYZ@WUeSDRURx@R=RƦ@RkR@R6QQ*@Q@QaQ@Q@Q~`Qw@Qq1QkQ^QR@Q/FQ-@Q@Q@Q \PDP@PPPYP7lPkP@OOO@O^@O#O O O\@O\@OOO OgOc+@OOdOG{OB5O:LO1@O1@O NNؽNN=@NS@Nw.NoEN[@N +MM3@M@Mx@Mx@MMMtM] MQ0@M.@ME@L!L!LLL7L|LLLLLLuLjyLbLZLF@L@IL;L4l@L(LLK@K@K/K]K#@KKŮ@K"@KK@KP@K,K8@K@K~}@K]K]K0K+nK @K K KK>JJ@JJJTJ%J1@JJ$J@J@J@J Jn@Ji@JhPJ[!IcIIд@Iд@I@II~@I{Il@IeI5#@I5#@IIIP@H*H@H@Hd@H^>H\@HXHI&HG@HE2@H>H2@G@G@G@GVG/F@F%@FGFS@F;@FR@F @FvsFiDF @FpF|@F6@F F@E{@E{@EEz@EE2@Ew@Eu_@E+@E#@EE@D@D{D5D@D@DYDYDD@D $@DC@C.CC@CQ@CC@CqCu@CqC=(Bw@BBp@Bh@B[@B,B@BBAAbA(@A(@AAAʳ@A@AwA[@A>@AA,A@@@@@@@@z@@9@@2@@,@??Y@?p5?W)@?T@?'@?>@>>>F>tg@>q@>m>l~@==b@Michal Hlavinka - 1:2.2.36-8Michal Hlavinka - 1:2.2.36-7.1Michal Hlavinka - 1:2.2.36-7Michal Hlavinka - 1:2.2.36-6Michal Hlavinka - 1:2.2.36-5Michal Hlavinka - 1:2.2.36-4Michal Hlavinka - 1:2.2.36-3Michal Hlavinka - 1:2.2.36-2Michal Hlavinka - 1:2.2.36-1Michal Hlavinka - 1:2.2.10-8Michal Hlavinka - 1:2.2.10-7Michal Hlavinka - 1:2.2.10-6Michal Hlavinka - 1:2.2.10-5Daniel Mach - 1:2.2.10-4Honza Horak - 1:2.2.10-3Michal Hx0cXY`$a PHaYэh^<`xRXWr$}.0RC5-dev)- new snapshot (5.4.0RC4-dev)- new snapshot (5.4.0RC4-dev) - switch to systemd- new snapshot (5.4.0RC4-dev) - removed patch merged upstream for https://bugs.php.net/60392 - clean ini (from upstream production default)- new snapshot (5.4.0RC3-dev) - patch for https://bugs.php.net/60392 (old libicu on EL-5)- new snapshot (5.4.0RC2-dev) - sync with latest changes in 5.3 spec- new snapshot - build mysql/mysqli against both libmysql and mysqlnd (new mysqlnd sub-package)- first work on php 5.4 - remove -sqlite subpackage - move php/modules-zts to php-zts/modulesphp53-xmlrpcphp53u-xmlrpcphp54-xmlrpcphp54w-xmlrpcphp55u-xmlrpcphp55w-xmlrpcphp56u-xmlrpcphp56w-xmlrpcphp70u-xmlrpcphp70w-xmlrpc7.0.33-42.el7.remi7.0.33-42.el7.remi7.0.33-42.el7.remi30-xmlrpc.ini30-xmlrpc.inixmlrpc.soxmlrpc.so/etc/php-zts.d//etc/php.d//usr/lib64/php-zts/modules//usr/lib64/php/modules/-O2 -g -pipe -Wall -Wp,-D_FORTIFY_SOURCE=2 -fexceptions -fstack-protector-strong --param=ssp-buffer-size=4 -grecord-gcc-switches -specs=/usr/lib/rpm/redhat/redhat-hardened-cc1 -m64 -mtune=genericcpioxz2x86_64-redhat-linux-gnuASCII textELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=7911400aa7471dcd1cc3a60b21a0435f95271842, strippedELF 64-bit LSB shared object, x86-64, version 1 (SYSV), dynamically linked, BuildID[sha1]=a342d1f941f911b97961e36a149f3b09c1fea51c, stripped R RRRRRR R RRR RRRRRRRR R RRRRhttps://forum.remirepo.net/?@TD_䶺Ţ +]!LΈJ]NoGVf`$ NoGVzT$i/,w3w*`3Υ|qΕ]!LΈJ]NoGVf`$ NoGV-/!^We/qwK,,1k0sJSA13ebb41c2d44e9686189335badae0f98e5b7c697g v&Lg u about trackpoint presence (Benjamin Tissoires) [1157840 1188234] - [input] elantech - provide a sysfs knob for crc_enabled (Benjamin Tissoires) [1157840 1188234] - [input] elantech - report the middle button of the touchpad (Benjamin Tissoires) [1157840 1188234] - [input] elantech - fix crc_enabled for Fujitsu H730 (Benjamin Tissoires) [1157840 1188234] - [input] elantech - use elantech_report_trackpoint for hardware v4 too (Benjamin Tissoires) [1157840 1188234] - [input] add missing POINTER / DIRECT properties to a bunch of drivers (Benjamin Tissoires) [1157840 1188234] - [input] add INPUT_PROP_POINTING_STICK property (Benjamin Tissoires) [1157840 1188234] - [input] elantech - fix detection of touchpad on ASUS s301l (Benjamin Tissoires) [1157840 1188234] - [input] elantech - add support for trackpoint found on some v3 models (Benjamin Tissoires) [1157840 1188234] - [input] elantech - reset the device when elantech probe fails (Benjamin Tissoires) [1157840 1188234] - [input] elantech - don't set bit 1 of reg_10 when the no_hw_res quirk is set (Benjamin Tissoires) [1157840 1188234] - [input] elantech - deal with clickpads reporting right button events (Benjamin Tissoires) [1157840 1188234] - [input] elantech - fix touchpad initialization on Gigabyte U2442 (Benjamin Tissoires) [1157840 1188234] - [input] elantech - add support for newer elantech touchpads (Benjamin Tissoires) [1157840 1188234] - [input] elantech - improve clickpad detection (Benjamin Tissoires) [1157840 1188234] - [input] elantech - add support for newer (August 2013) devices (Benjamin Tissoires) [1157840 1188234] - [input] elantech - fix packet check for v3 and v4 hardware (Benjamin Tissoires) [1157840 1188234] - [input] elantech - fix for newer hardware versions (v7) (Benjamin Tissoires) [1157840 1188234] - [x86] kvm: zero kvmclock_offset when vcpu0 initializes kvmclock system MSR (Marcelo Tosatti) [1184155] - [x86] kvmclock: set scheduler clock stable (Marcelo Tosatti) [1184155] - [x86] kvmclock: add flag to indicate pvclock counts fromxBX[W@j$g> - 7.1.3-0.2.RC1Remi Collet - 7.1.3-0.1.RC1Remi Collet - 7.1.2-1Remi Collet - 7.1.2-0.2.RC1Remi Collet 7.1.2-0.1.RC1Remi Collet 7.1.1-3Remi Collet 7.1.1-2Remi Collet 7.1.1-1Remi Collet 7.1.1-0.1.RC1Remi Collet 7.1.0-2Remi Collet 7.1.0-1Remi Collet 7.1.0-0.13.RC6Remi Collet 7.1.0-0.12.RC5Remi Collet 7.1.0-0.11.RC4Remi Collet 7.1.0-0.10.RC3Remi Collet 7.1.0-0.9.RC3Remi Collet 7.1.0-0.8.RC2Remi Collet 7.1.0-0.8.RC1Remi Collet 7.1.0-0.7.beta2Remi Collet 7.1.0-0.6.beta1Remi Collet 7.1.0-0.5.alpha3Remi Collet 7.1.0-0.4.alpha2Remi Collet 7.1.0-0.3.alpha2Remi Collet 7.1.0-0.2.alpha2Remi Collet 7.1.0-0.1.alpha1Remi Collet 7.0.7-1Remi Collet 7.0.7-0.1.RC1Remi Collet 7.0.6-3Remi Collet 7.0.6-2Remi Collet 7.0.6-0.2.RC1Remi Collet 7.0.5-2Remi Collet 7.0.5-1Remi Collet 7.0.5-0.1.RC1Remi Collet 7.0.4-2Remi Collet 7.0.4-1Remi Collet 7.0.4-0.1.RC1Remi Collet 7.0.3-1Remi Collet 7.0.3-0.3.20160129gitdd3d10cRemi Collet 7.0.3-0.2.RC1Remi Collet 7.0.3-0.1.RC1Remi Collet 7.0.2-1Remi Collet 7.0.2-0.1.RC1Remi Collet 7.0.1-1Remi Collet 7.0.1-0.1.RC1Remi Collet 7.0.0-2Remi Collet 7.0.0-1Remi Collet 7.0.0-0.26.RC8Remi Collet 7.0.0-0.25.RC8Remi Collet 7.0.0-0.24.RC7Remi Collet 7.0.0-0.23.RC7Remi Collet 7.0.0-0.22.RC6Remi Collet 7.0.0-0.21.RC5Remi Collet 7.0.0-0.20.RC5Remi Collet 7.0.0-0.19.RC5Remi Collet 7.0.0-0.18.RC4Remi Collet 7.0.0-0.17.RC3Remi Collet 7.0.0-0.16.RC3Remi Collet 7.0.0-0.15.RC2Remi Collet 7.0.0-0.14.RC1Remi Collet 7.0.0-0.13.beta3Remi Collet 7.0.0-0.12.beta2Remi Collet 7.0.0-0.11.beta1Remi Collet 7.0.0-0.10.alpha2Remi Collet 7.0.0-0.9.20150617git3697f02Remi Collet 7.0.0-0.9.20150611git8cfe282Remi Collet 7.0.0-0.8.alpha1Remi Collet 7.0.0-0.7.20150602git8a089e7Remi Collet 7.0.0-0.7.20150525git6f46fa3Remi Collet 7.0.0-0.6.20150525git404360fRemi Collet 7.0.0-0.6.20150518gitcee8857Remi Collet 7.0.0-0.6.20150515gitc9f27eeRemi Collet 7.0.0-0.6.20150507gitdd0b602Remi Collet 7.0.0-0.5.20150428git94f0b94Remi Collet 7.0.0-0.5.20150427git1a4d3e4Remi Collet 7.0.0-0.5.20150418git1f0a624Remi Collet 7.0.0-0.5.20150416gitc77d97fRemi Collet 7.0.0-0.5.20150403gitadcf0c6Remi Collet 5.5.10-0.4.RC1Remi Collet 5.5.10-0.3.RC1Remi Collet 5.5.10-0.2.RC1Remi Collet 5.5.10-0.1.RC1Remi Collet 5.5.9-2Remi Collet 5.5.9-1Remi Collet 5.5.9-0.1.RC1Joe Orton - 5.5.8-2Remi Collet 5.5.8-2Remi Collet 5.5.8-1Remi Collet 5.5.8-0.2.RC1Remi Collet 5.5.8-0.1.RC1Remi Collet 5.5.7-1.1Remi Collet 5.5.7-1Remi Collet 5.5.7-0.4.RC1Remi Collet 5.5.7-0.3.RC1Remi Collet 5.5.7-0.2.RC1Remi Collet 5.5.7-0.1.RC1Remi Collet 5.5.6-1Remi Collet 5.5.6-0.7Remi Collet 5.5.6-0.6.RC1Remi Collet 5.5.6-0.5.RC1Remi Collet 5.5.6-0.4.RC1Remi Collet 5.5.6-0.3.RC1Remi Collet 5.5.6-0.2.RC1Remi Collet 5.5.6-0.1.RC1Remi Collet 5.5.5-2Remi Collet - 5.5.5-1Remi Collet - 5.5.4-2Remi Collet - 5.5.4-1Remi Collet - 5.5.4.0.1-201308300430Remi Collet - 5.5.3-1Remi Collet - 5.5.3-0Remi Collet - 5.5.2-1Remi Collet - 5.5.2-0.2.RC1Remi Collet - 5.5.2-0.1.RC1Remi Collet - 5.5.1-2Remi Collet - 5.5.1-1Remi Collet - 5.5.0-2Remi Collet 5.5.1-0.1.201306240630Remi Collet 5.5.0-1Remi Collet 5.5.0-0.11.RC3Remi Collet 5.5.0-0.36.RC3.1Remi Collet 5.5.0-0.36.RC3Remi Collet 5.5.0-0.35.RC3Remi Collet 5.5.0-0.34.201305271230.Remi Collet 5.5.0-0.33.RC2Remi Collet 5.5.0-0.32.201305220430Remi Collet 5.5.0-0.32.201305181030Remi Collet 5.5.0-0.31.RC1Remi Collet 5.5.0-0.30.201305041230Remi Collet 5.5.0-0.29.201304291030Remi Collet 5.5.0-0.28.beta4Remi Collet 5.5.0-0.27.beta4Remi Collet 5.5.0-0.27-201304221230Remi Collet 5.5.0-0.26-201304181030Remi Collet 5.5.0-0.25.beta3Remi Collet 5.5.0-0.24.beta3Remi Collet 5.5.0-0.23-201304040630Remi Collet 5.5.0-0.22.beta2Remi Collet 5.5.0-0.21-201303251230Remi Collet 5.5.0-0.20-201303201430Remi Collet 5.5.0-0.19-201303180830Remi Collet 5.5.0-0.18-201303141230Remi Collet 5.5.0-0.17-201303081230Remi Collet 5.5.0-0.16-201302281430Remi Collet 5.5.0-0.16-201302211230Remi Collet 5.5.0-0.16-201302131030Remi Collet 5.5.0-0.15-201302121230Remi Collet 5.5.0-0.14-201302040630Remi Collet 5.5.0-0.14-201302010630Remi Collet 5.5.0-0.13-201301281030Remi Collet 5.5.0-0.12-201301230630Remi Collet 5.5.0-0.11-201301170830Remi Collet 5.5.0-0.10-201301100830Remi Collet 5.5.0-0.10-201301021430Remi Collet 5.5.0-0.9.201212241030Remi Collet 5.5.0-0.9.201212181230Remi Collet 5.5.0-0.8.201212121430Remi Collet @GHI(X0Y<\X]p^bdefltuvwxy   "4 "D $\$$$g$h$Cdbus-glib0.1007.el7GLib bindings for D-Bus D-Bus add-on library to integrate the standard D-Bus library with the GLib thread abstraction and main loop.S,worker1.bsys.centos.orgCentOSAFL and GPLv2+CentOS BuildSystem System Environment/Librarieshttp://www.freedesktop.org/software/dbus/linuxx86_64yxq}ȁA큤S,S+S,S,NpNzl79d3116e7dcaaa484750d816cef5c283c00facec92e0531922537cf4eac23de9d1f2d6c6032ee1152b4fe9fefd1c504b9aaea91e661c65fea9f9c46f305d8bdcef1634fc21d9112dca08f2557313584719d534d05213cf14f3c77938506266b417c03ca8b5a3de9af679914448c17df358d55cf33f88678d212c22f2ff0686a6libdbus-glib-1.so.2.2.2rootrootrootrootrootrootrootrootrootrootrootrootdbus-glib-0.100-7.el7.src.rpmdbus-glibdbus-glib(x86-64)libdbus-glib-1.so.2()(64bit) @@@@@@@@@@@   @ /sbin/ldconfig/sbin/ldconfigchkconfiglibc.so.6()(64bit)libc.so.6(GLIBC_2.14)(64bit)libc.so.6(GLIBC_2.2.5)(64bit)libc.so.6(GLIBC_2.3.4)(64bit)libc.so.6(GLIBC_2.4)(64bit)libdbus-1.so.3()(64bit)libdbus-glib-1.so.2()(64bit)libexpat.so.1()(64bit)libgio-2.0.so.0()(64bit)libglib-2.0.so.0()(64bit)libgobject-2.0.so.0()(64bit)rpmlib(CompressedFileNames)rpmlib(FileDigests)rpmlib(PayloadFilesHavePrefix)rtld(GNU_HASH)rpmlib(PayloadIsXz)1.3.263.0.4-14.6.0-14.0-15.2-14.11.1RURkQo@Q@@Q$Q@PSOMQ0@M:L*@L@Lc@L;L)@L)@KKKy7@K`*KPXJi@J_@J4@I@I@Id@I7@I+I!\H@HG@H;H"@HG@G@G@G@G@)@GFF@FuF@E@Emv@EM@E - 0.100-7Daniel Mach - 0.100-6Colin Walters - 0.100-5Matthias Clasen - 0.100-4Colin Walters - 0.100-3Fedora Release Engineering - 0.100-2Colin Walters - 0.100-1Fedora Release Engineering - 0.92-3Fedora Release Engineering - 0.92-2Christopher Aillon - 0.92-1jkeating - 0.88-3Colin Walters - 0.88-2Colin Walters - 0.88-1Colin Walters - 0.86-4Dan Williams - 0.86-3Bastien Nocera 0.86-2Colin Walters - 0.86-1Colin Walters - 0.84-3Colin Walters - 0.84-2Colin Walters - 0.84-1Colin Walters - 0.82-3Fedora Release Engineering - 0.82-2Colin Walters - 0.82-1Matthias Clasen - 0.80-3Fedora Release Engineering - 0.80-2Colin Walters - 0.80-1Colin Walters = 21- Update to 7.0.1RC1 - drop --disable-huge-code-pages build option on EL-6, but keep it disabled in default configuration- build with --disable-huge-code-pages on EL-6- Update to 7.0.0 http://www.php.net/releases/7_0_0.php- set opcache.huge_code_pages=0 on EL-6 see https://bugs.php.net/70973 and https://bugs.php.net/70977- Update to 7.0.0RC8 - set opcache.huge_code_pages=1 on x86_64- Update to 7.0.0RC7 (retagged)- Update to 7.0.0RC7- Update to 7.0.0RC6- php-config: reports all built sapis- rebuild as retagged- Update to 7.0.0RC5 - update php-fpm.d/www.conf comments - API and Zend API are now set to 20151012- Update to 7.0.0RC4 - php-fpm: set http authorization headers- F23 rebuild with rh_layout- Update to 7.0.0RC3 - disable zip extension (provided in php-pecl-zip)- Update to 7.0.0RC2 - enable oci8 and pdo_oci extensions - sync php.ini with upstream php.ini-production- Update to 7.0.0RC1- Update to 7.0.0beta3- Update to 7.0.0beta2 - switch from libvpx to libwebp (only for bundled libgd, not used)- Update to 7.0.0beta1 - use upstream tarball instead of git snapshot- Update to 7.0.0alpha2 - use new layout (/etc/opt, /var/opt)- new snapshot- new snapshot - the phar link is now correctly created- Update to 7.0.0alpha1- new snapshot- new snapshot - t1lib support have been removed- new snapshot- new snapshot- new snapshot- add experimental file based opcode cache (disabled by default)- new snapshot- new snapshot - adapt system tzdata patch for upstream change for new zic- new snapshot- new snapshot- new snapshot- rename 10-php70-php.conf to 15-php70-php.conf to ensure load order (after 10-rh-php56-php.conf)- rebuild- fix mod_php configuration - disable static json - sync php.ini with upstream php.ini-production- update for php 7.0.0 - ereg, mssql, mysql and sybase_ct extensions are removed - add pdo-dblib subpackage (instead of php-mssql) - disable oci8 extension, not yet adapted for 7.0 - add php-zip subpackage - add php-json subpackage- Update to 5.6.7 http://www.php.net/releases/5_6_7.php- update to 5.6.7RC1- Update to 5.6.6 http://www.php.net/releases/5_6_6.php- Update to 5.6.5 http://www.php.net/releases/5_6_5.php- fix php-fpm.service.d location- update to 5.6.5RC1 - add base system path in default include path - FPM: enable ACL for Unix Domain Socket- Update to 5.6.4 http://www.php.net/releases/5_6_4.php - add sybase_ct extension (in mssql sub-package) - xmlrpc requires xml- Update to 5.xXV(d$tdecnu Matilainen - 4.8.0-6Panu Matilainen - 4.8.0-5Panu Matilainen - 4.8.0-4Panu Matilainen - 4.8.0-3Panu Matilainen - 4.8.0-2Panu Matilainen - 4.8.0-1Panu Matilainen - 4.8.0-0.beta1.6Panu Matilainen - 4.8.0-0.beta1.5Panu Matilainen - 4.8.0-0.beta1.4Panu Matilainen - 4.8.0-0.beta1.3Panu Matilainen - 4.8.0-0.beta1.2Panu Matilainen - 4.8.0-0.beta1.1Panu Matilainen - 4.7.2-2Panu Matilainen - 4.7.2-1Jindrich Novy - 4.7.1-10Jindrich Novy - 4.7.1-9Panu Matilainen - 4.7.1-8Panu Matilainen - 4.7.1-7Panu Matilainen - 4.7.1-6Panu Matilainen - 4.7.1-5Jesse Keating - 4.7.1-4Jindrich Novy - 4.7.1-3Fedora Release Engineering - 4.7.1-2Panu Matilainen - 4.7.1-1Bill Nottingham - 4.7.0-9Panu Matilainen - 4.7.0-8Panu Matilainen - 4.7.0-7Stepan Kasal - 4.7.0-6Panu Matilainen - 4.7.0-5Panu Matilainen - 4.7.0-4Panu Matilainen - 4.7.0-3Panu Matilainen - 4.7.0-2Panu Matilainen - 4.7.0-1Panu Matilainen - 4.7.0-0.rc1.1Panu Matilainen - 4.7.0-0.beta1.9Tom "spot" Callaway - 4.7.0-0.beta1.8Panu Matilainen - 4.7.0-0.beta1.7Panu Matilainen - 4.7.0-0.beta1.6Panu Matilainen - 4.7.0-0.beta1.5Panu Matilainen - 4.7.0-0.beta1.4Panu Matilainen - 4.7.0-0.beta1.3Panu Matilainen - 4.7.0-0.beta1.2Panu Matilainen - 4.7.0-0.beta1.1Panu Matilainen - 4.6.0-11Panu Matilainen - 4.6.0-10Panu Matilainen - 4.6.0-9Panu Matilainen - 4.6.0-8Panu Matilainen - 4.6.0-7Panu Matilainen - 4.6.0-6Jindrich Novy - 4.6.0-5Jindrich Novy - 4.6.0-4Panu Matilainen - 4.6.0-3Panu Matilainen - 4.6.0-2Panu Matilainen - 4.6.0-1Panu Matilainen - 4.6.0-0.rc4.5Panu Matilainen - 4.6.0-0.rc4.4Panu Matilainen - 4.6.0-0.rc4.3Panu Matilainen - 4.6.0-0.rc4.2Panu Matilainen - 4.6.0-0.rc4.1Panu Matilainen - 4.6.0-0.rc3.2Panu Matilainen - 4.6.0-0.rc3.1Panu Matilainen - 4.6.0-0.rc3.1Jeremy Katz - 4.6.0-0.rc2.9Jeremy Katz - 4.6.0-0.rc2.8Panu Matilainen Panu Matilainen Jindrich Novy Panu Matilainen Panu Matilainen Panu Matilainen Panu Matilainen Panu Matilainen Jindrich Novy Panu Matilainen Panu Matilainen Panu Matilainen Panu Matilainen Jindrich Novy Panu Matilainen Jindrich Novy Jindrich Novy Jindrich Novy Jindrich Novy Panu Matilainen Panu Matilainen Florian Festi Florian Festi x8Groupen@@jjj0z  pxH TMv|V @@Requirenamelete@x@8 @   h8 UȦZ6o@@Providenamename@x@8p Pp  X( V?@@Conflictname@x@8` `  8WtV @@Obsoletename@x@8pPp  ( (X%!@@Triggername@x@8`@\\\3 8 YV4͖#@@Dirnames@x@8@0 H @ ZkA.6$Installtid